Details of the Target

General Information of Target

Target ID LDTP03720
Target Name Merlin (NF2)
Gene Name NF2
Gene ID 4771
Synonyms
SCH; Merlin; Moesin-ezrin-radixin-like protein; Neurofibromin-2; Schwannomerlin; Schwannomin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
Target Type
Literature-reported
Target Bioclass
Other
Subcellular location
Cytoplasmic side; Nucleus; Cytoplasm, perinuclear region; Cell projection, filopodium membrane; Peripheral membrane protein
Function
Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex.
TTD ID
T95742
Uniprot ID
P35240
DrugMap ID
TTZIK7P
Ensemble ID
ENST00000334961.11
HGNC ID
HGNC:7773

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
8505C SNV: p.E129Ter .
CAL62 SNV: p.E215Ter .
CCK81 Deletion: p.R172GfsTer2 .
DU145 Deletion: p.E394del DBIA    Probe Info 
HEC1 SNV: p.Q320Ter .
KMCH1 SNV: p.R358S .
MDAMB231 SNV: p.E231Ter .
MFE319 SNV: p.Y132C .
NCIH1155 SNV: p.A403T .
NCIH2052 SNV: p.R341Ter DBIA    Probe Info 
NCIH2286 Insertion: p.I174NfsTer29
SNV: .		 .
NUGC3 Deletion: p.K228RfsTer23 .
REC1 Deletion: p.Y207Ter .
RKO Deletion: p.P275HfsTer21 .
RL952 Deletion: p.R172GfsTer2
SNV: p.Q362Ter		 .
SKHEP1 SNV: p.I264V .
SKMEL28 SNV: p.L398M DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C300(1.45)  LDD3312  [1]
4-Iodoacetamidophenylacetylene
 Probe Info  		C51(0.00); C133(0.00)  LDD0038  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A101D C92(1.67)  LDD2250  [1]
 LDCM0023  KB03 A101D C92(2.96)  LDD2667  [1]
 LDCM0024  KB05 HMCB C300(1.45)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
COP9 signalosome complex subunit 3 (COPS3) CSN3 family Q9UNS2
Eukaryotic translation initiation factor 3 subunit F (EIF3F) EIF-3 subunit F family O00303
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Ubiquitin thioesterase OTUB1 (OTUB1) Peptidase C65 family Q96FW1
MPN domain-containing protein (MPND) Peptidase M67 family Q8N594
E3 SUMO-protein ligase PIAS1 (PIAS1) PIAS family O75925
Serine/threonine-protein kinase LATS1 (LATS1) AGC Ser/Thr protein kinase family O95835
Mitogen-activated protein kinase kinase kinase 11 (MAP3K11) STE Ser/Thr protein kinase family Q16584
Atlastin-1 (ATL1) GB1/RHD3 GTPase family Q8WXF7
GTP-binding protein 4 (GTPBP4) OBG GTPase family Q9BZE4
E3 ubiquitin-protein ligase CBL-B (CBLB) . Q13191
E3 ubiquitin-protein ligase CHIP (STUB1) . Q9UNE7
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
E3 ubiquitin-protein ligase RNF138 (RNF138) . Q8WVD3
E3 ubiquitin-protein ligase RNF183 (RNF183) . Q96D59
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Spectrin beta chain, non-erythrocytic 1 (SPTBN1) Spectrin family Q01082
Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF1) . O14745
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 436 (ZNF436) Krueppel C2H2-type zinc-finger protein family Q9C0F3
Zinc finger protein 497 (ZNF497) Krueppel C2H2-type zinc-finger protein family Q6ZNH5
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein with KRAB and SCAN domains 8 (ZKSCAN8) Krueppel C2H2-type zinc-finger protein family Q15776
Visual system homeobox 2 (VSX2) Paired homeobox family P58304
Other
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Angiomotin (AMOT) Angiomotin family Q4VCS5
Angiomotin-like protein 2 (AMOTL2) Angiomotin family Q9Y2J4
Protein BEX5 (BEX5) BEX family Q5H9J7
Bystin (BYSL) Bystin family Q13895
26S proteasome complex subunit SEM1 (SEM1) DSS1/SEM1 family P60896
Protein FAM9A (FAM9A) FAM9 family Q8IZU1
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Mediator of RNA polymerase II transcription subunit 28 (MED28) Mediator complex subunit 28 family Q9H204
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Translin-associated protein X (TSNAX) Translin family Q99598
Vacuolar protein sorting-associated protein 37A (VPS37A) VPS37 family Q8NEZ2
Emerin (EMD) . P50402
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
InaD-like protein (PATJ) . Q8NI35
Nebulette (NEBL) . O76041
Pleckstrin homology domain-containing family G member 7 (PLEKHG7) . Q6ZR37
RING1 and YY1-binding protein (RYBP) . Q8N488
RUN and FYVE domain-containing protein 4 (RUFY4) . Q6ZNE9
Spermatogenesis-associated protein 22 (SPATA22) . Q8NHS9
TNFAIP3-interacting protein 3 (TNIP3) . Q96KP6

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060