Details of the Target
General Information of Target
| Target ID | LDTP03597 | |||||
|---|---|---|---|---|---|---|
| Target Name | Syndecan-4 (SDC4) | |||||
| Gene Name | SDC4 | |||||
| Gene ID | 6385 | |||||
| Synonyms |
Syndecan-4; SYND4; Amphiglycan; Ryudocan core protein |
|||||
| 3D Structure | ||||||
| Sequence |
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY DLGKKPIYKKAPTNEFYA |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Syndecan proteoglycan family
|
|||||
| Subcellular location |
Secreted; Membrane
|
|||||
| Function | Cell surface proteoglycan which regulates exosome biogenesis in concert with SDCBP and PDCD6IP. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
|
OPA-S-S-alkyne Probe Info |
![]() |
K105(3.81); K114(3.81); K104(3.81) | LDD3494 | [2] | |
|
Probe 1 Probe Info |
![]() |
Y180(11.47) | LDD3495 | [3] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protein kinase C alpha type (PRKCA) | AGC Ser/Thr protein kinase family | P17252 | |||
Transporter and channel
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Probable G-protein coupled receptor 179 (GPR179) | G-protein coupled receptor 3 family | Q6PRD1 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interleukin-7 receptor subunit alpha (IL7R) | Type I cytokine receptor family | P16871 | |||
Other
References



