Details of the Target
General Information of Target
| Target ID | LDTP03514 | |||||
|---|---|---|---|---|---|---|
| Target Name | GTP cyclohydrolase 1 feedback regulatory protein (GCHFR) | |||||
| Gene Name | GCHFR | |||||
| Gene ID | 2644 | |||||
| Synonyms |
GFRP; GTP cyclohydrolase 1 feedback regulatory protein; GFRP; GTP cyclohydrolase I feedback regulatory protein; p35 |
|||||
| 3D Structure | ||||||
| Sequence |
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKL
ERRGFRVLSMTGVGQTLVWCLHKE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GFRP family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
5E-2FA Probe Info |
 |
N.A. | LDD2235 | [1] | |
|
HHS-465 Probe Info |
 |
N.A. | LDD2240 | [2] | |
References