Details of the Target

General Information of Target

Target ID	LDTP03459
Target Name	Tumor necrosis factor receptor superfamily member 8 (TNFRSF8)
Gene Name	TNFRSF8
Gene ID	943
Synonyms	CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Target Type	Successful
Target Bioclass	Cytokine and receptor
Family	TNFR8 family
Subcellular location	Cytoplasm; Cell membrane
Function	Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
TTD ID	T88023
Uniprot ID	P28908
DrugMap ID	TT2GM5R
Ensemble ID	ENST00000263932.7
HGNC ID	HGNC:11923
ChEMBL ID	CHEMBL2364161

Target Site Mutations in Different Cell Lines

Cell line	Mutation details	Probe for labeling this protein in this cell
COLO829	SNV: p.P215S	.
DEL	SNV: p.T557P	.
DU145	SNV: p.V311I	.
IGR37	SNV: p.D574Y	.
KELLY	SNV: p.M469R	.
MFE319	SNV: p.C160R; p.R441K	.
MOLT4	SNV: p.E164D	.
NCIH1155	SNV: p.P456T	.
OVCAR5	SNV: p.F324L	.
SNU1196	SNV: p.L548F	.

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
DBIA Probe Info			C69(9.89)	LDD0209	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0022	KB02	CHL1	C423(1.80)	LDD2475	[2]
LDCM0023	KB03	Jurkat	C69(9.89)	LDD0209	[1]
LDCM0024	KB05	COLO792	C423(3.63)	LDD3310	[2]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved

Click To Hide/Show 1 Drug(s) Interacting with This Target

Drug Name				Drug Type	External ID
Brentuximab Vedotin				Monoclonal antibody	D03TIS

Phase 2

Click To Hide/Show 9 Drug(s) Interacting with This Target

Drug Name	Drug Type	External ID
Afm13	Antibody	DZM2L1
Iratumumab	Antibody	D00MBR
Sgn-30	Antibody	D0S0MP
Anti-cd30 Car T Cells	CAR T Cell Therapy	D04ACK
Anti-cd30-car-transduced T Cells	CAR T Cell Therapy	D0W2MI
Car-t Cells Targeting Cd30	CAR T Cell Therapy	D0UA0U
Car.Cd30 Cells	CAR T Cell Therapy	D0I5GS
Cart30	CAR T Cell Therapy	D0FZ1Y
4scar19 And 4scar30	CAR T Cell Therapy (Dual specific)	D0K8YX

Phase 1

Click To Hide/Show 9 Drug(s) Interacting with This Target

Drug Name	Drug Type	External ID
Xmab-2513	Antibody	D06ALK
Sgn-cd30c	Antibody drug conjugate	DDG8W9
Anti-cd30 Car-t Cells	CAR T Cell Therapy	D0H2LC
Anti-cd30-car T Cells	CAR T Cell Therapy	D0TC6X
Atlcar.Cd30 Cells	CAR T Cell Therapy	D0GA8I
Car Cd30 T Cells	CAR T Cell Therapy	D0N2AM
Cd30 Car T Cells	CAR T Cell Therapy	D0S3YV
Icar30 T Cells	CAR T Cell Therapy	D08ZAC
Atlcar.Cd30.Ccr4 Cells	CAR T Cell Therapy (Dual specific)	D0U5AQ

Investigative

Click To Hide/Show 3 Drug(s) Interacting with This Target

Discontinued

Click To Hide/Show 1 Drug(s) Interacting with This Target

Drug Name				Drug Type	External ID
Ber-h2/Saporin				Antibody	D0A9QL

References

1	Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
2	DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22. Mass spectrometry data entry: PXD047840