Details of the Target

General Information of Target

Target ID LDTP03389
Target Name V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C)
Gene Name ATP6V0C
Gene ID 527
Synonyms
ATP6C; ATP6L; ATPL; V-type proton ATPase 16 kDa proteolipid subunit c; V-ATPase 16 kDa proteolipid subunit c; Vacuolar proton pump 16 kDa proteolipid subunit c
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV
MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Target Bioclass
Enzyme
Family
V-ATPase proteolipid subunit family
Subcellular location
Cytoplasmic vesicle, clathrin-coated vesicle membrane
Function
Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.
Uniprot ID
P27449
Ensemble ID
ENST00000330398.9
HGNC ID
HGNC:855

Probe(s) Labeling This Target

PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
OEA-DA
 Probe Info  		20.00  LDD0046  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
Proteasome subunit alpha type-3 (PSMA3) Peptidase T1A family P25788
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
Ceramide synthase 2 (CERS2) . Q96G23
Macrophage scavenger receptor types I and II (MSR1) . P21757
Transporter and channel
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Stomatin (STOM) Band 7/mec-2 family P27105
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
NIPA-like protein 3 (NIPAL3) NIPA family Q6P499
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Proton-transporting V-type ATPase complex assembly regulator TMEM9 (TMEM9) TMEM9 family Q9P0T7
Solute carrier family 35 member E3 (SLC35E3) TPT transporter family Q7Z769
Early activation antigen CD69 (CD69) . Q07108
Transmembrane protein 139 (TMEM139) . Q8IV31
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Enhancer of rudimentary homolog (ERH) E(R) family P84090
DnaJ homolog subfamily C member 1 (DNAJC1) . Q96KC8
GPCR
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Probable G-protein coupled receptor 25 (GPR25) G-protein coupled receptor 1 family O00155
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Programmed cell death 1 ligand 2 (PDCD1LG2) BTN/MOG family Q9BQ51
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR) . Q9H7M9
Cytokine and receptor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ectodysplasin-A (EDA) Tumor necrosis factor family Q92838
Interleukin-7 receptor subunit alpha (IL7R) Type I cytokine receptor family P16871
Interleukin-10 receptor subunit alpha (IL10RA) Type II cytokine receptor family Q13651
Tumor necrosis factor receptor superfamily member 27 (EDA2R) . Q9HAV5
Other
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Peptidase inhibitor 16 (PI16) CRISP family Q6UXB8
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein EVI2A (EVI2A) EVI2A family P22794
Protein FAM210B, mitochondrial (FAM210B) FAM210 family Q96KR6
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Zinc finger CCHC domain-containing protein 12 (ZCCHC12) ZCCHC12 family Q6PEW1
C-type lectin domain family 14 member A (CLEC14A) . Q86T13
C-type lectin domain family 17, member A (CLEC17A) . Q6ZS10
Diablo IAP-binding mitochondrial protein (DIABLO) . Q9NR28
Fibronectin type III domain-containing protein 9 (FNDC9) . Q8TBE3
Leucine-rich repeat-containing protein 25 (LRRC25) . Q8N386
Mast cell-expressed membrane protein 1 (MCEMP1) . Q8IX19
NKG2-A/NKG2-B type II integral membrane protein (KLRC1) . P26715
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3
Small integral membrane protein 3 (SMIM3) . Q9BZL3
Sperm acrosome membrane-associated protein 1 (SPACA1) . Q9HBV2
Sushi domain-containing protein 3 (SUSD3) . Q96L08

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Tiludronic Acid Small molecular drug DB01133

References

1 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570