Details of the Target
General Information of Target
| Target ID | LDTP03389 | |||||
|---|---|---|---|---|---|---|
| Target Name | V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) | |||||
| Gene Name | ATP6V0C | |||||
| Gene ID | 527 | |||||
| Synonyms |
ATP6C; ATP6L; ATPL; V-type proton ATPase 16 kDa proteolipid subunit c; V-ATPase 16 kDa proteolipid subunit c; Vacuolar proton pump 16 kDa proteolipid subunit c |
|||||
| 3D Structure | ||||||
| Sequence |
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV
MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
V-ATPase proteolipid subunit family
|
|||||
| Subcellular location |
Cytoplasmic vesicle, clathrin-coated vesicle membrane
|
|||||
| Function |
Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
OEA-DA Probe Info |
![]() |
20.00 | LDD0046 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Enhancer of rudimentary homolog (ERH) | E(R) family | P84090 | |||
| DnaJ homolog subfamily C member 1 (DNAJC1) | . | Q96KC8 | |||
GPCR
Immunoglobulin
Cytokine and receptor
Other

