Details of the Target
General Information of Target
| Target ID | LDTP03383 | |||||
|---|---|---|---|---|---|---|
| Target Name | Annexin A13 (ANXA13) | |||||
| Gene Name | ANXA13 | |||||
| Gene ID | 312 | |||||
| Synonyms |
ANX13; Annexin A13; Annexin XIII; Annexin-13; Intestine-specific annexin; ISA |
|||||
| 3D Structure | ||||||
| Sequence |
MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATY
GKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKE IIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLV RCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVR SDTSGDFRKLLVALLH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Annexin family
|
|||||
| Subcellular location |
Apical cell membrane
|
|||||
| Function |
[Isoform A]: Binds to membranes enriched in phosphatidylserine or phosphatidylglycerol in a calcium-dependent manner. Half-maximal membrane binding requires about 60 uM calcium. Does not bind to membranes that lack phospholipids with an acidic headgroup.; [Isoform B]: Binds to membranes enriched in phosphatidylserine or phosphatidylglycerol in a calcium-dependent manner, but requires higher calcium levels for membrane binding than isoform A. Half-maximal membrane binding requires about 320 uM calcium.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C155(1.15) | LDD2379 | [1] | |
Competitor(s) Related to This Target