Details of the Target
General Information of Target
| Target ID | LDTP03335 | |||||
|---|---|---|---|---|---|---|
| Target Name | Rhombotin-1 (LMO1) | |||||
| Gene Name | LMO1 | |||||
| Gene ID | 4004 | |||||
| Synonyms |
RBTN1; RHOM1; TTG1; Rhombotin-1; Cysteine-rich protein TTG-1; LIM domain only protein 1; LMO-1; T-cell translocation protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN QRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C334(1.77) | LDD3423 | [1] | |
Competitor(s) Related to This Target