Details of the Target
General Information of Target
| Target ID | LDTP03326 | |||||
|---|---|---|---|---|---|---|
| Target Name | DnaJ homolog subfamily B member 2 (DNAJB2) | |||||
| Gene Name | DNAJB2 | |||||
| Gene ID | 3300 | |||||
| Synonyms |
HSJ1; HSPF3; DnaJ homolog subfamily B member 2; Heat shock 40 kDa protein 3; Heat shock protein J1; HSJ-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ EGARGEATKRSPSPEEKASRCLIL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Endoplasmic reticulum membrane
|
|||||
| Function |
Functions as a co-chaperone, regulating the substrate binding and activating the ATPase activity of chaperones of the HSP70/heat shock protein 70 family. In parallel, also contributes to the ubiquitin-dependent proteasomal degradation of misfolded proteins. Thereby, may regulate the aggregation and promote the functional recovery of misfolded proteins like HTT, MC4R, PRKN, RHO and SOD1 and be crucial for many biological processes. Isoform 1 which is localized to the endoplasmic reticulum membranes may specifically function in ER-associated protein degradation of misfolded proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |

