Details of the Target

General Information of Target

Target ID LDTP03312
Target Name Platelet-activating factor receptor (PTAFR)
Gene Name PTAFR
Gene ID 5724
Synonyms
PAFR; Platelet-activating factor receptor; PAF-R; PAFr
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Target Type
Successful
Target Bioclass
GPCR
Family
G-protein coupled receptor 1 family
Subcellular location
Cell membrane
Function
Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
TTD ID
T87023
Uniprot ID
P25105
DrugMap ID
TTQL5VC
Ensemble ID
ENST00000305392.3
HGNC ID
HGNC:9582
ChEMBL ID
CHEMBL250

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		N.A.  LDD0166  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Focal adhesion kinase 1 (PTK2) Tyr protein kinase family Q05397

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Rupatadine Small molecular drug DB11614
Ticlopidine Small molecular drug D05LBU
Phase 4
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Rupatadine Small molecular drug D0S1CQ
Phase 3
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Israpafant Small molecular drug D0D4ZM
Phase 2
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
60p002 Small molecular drug DA85NC
Cmi-392 Small molecular drug D0D5ZV
Dersalazine Small molecular drug D0ZI0C
Lexipafant Small molecular drug D0I0UE
Ym-264 Small molecular drug D0W6AF
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pegcntf Small molecular drug D0C2HI
Investigative
Click To Hide/Show 34 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
10-obn-7alpha-f-gingkolide B Small molecular drug D0NB4Q
10-obn-epi-ginkgolide C Small molecular drug D0Z6BO
10-obn-ginkgolide B Small molecular drug D0I7RF
10-obn-ginkgolide C Small molecular drug D0J6WM
2-o-ethyl-paf C-16 Small molecular drug D03WIK
2-o-methyl-paf C-18 Small molecular drug D0A8PD
7-epi-ginkgolide C Small molecular drug D07DAK
7alpha-cl-ginkgolide B Small molecular drug D07FPS
7alpha-f-ginkgolide B Small molecular drug D07TQF
7alpha-n3-ginkgolide B Small molecular drug D09FQT
7alpha-nh2-ginkgolide B Small molecular drug D0D1NQ
7alpha-nhet-ginkgolide B Small molecular drug D0Q6EK
7alpha-nhme-ginkgolide B Small molecular drug D0BV8A
7alpha-oac-ginkgolide B Small molecular drug D05XSV
7alpha-ococh2ph-ginkgolide B Small molecular drug D05BJY
A 137491 Small molecular drug D0AN6L
Bb-823 Small molecular drug D0X9RL
Cv-3988 Small molecular drug D0N2WK
Enantio Paf C-16 Small molecular drug D06AUX
Fr-900452 Small molecular drug D09PTR
Ko-286011 Small molecular drug D04GGK
L-652731 Small molecular drug D01CDL
Methylcarbamyl Paf Small molecular drug D09BLB
Paf Small molecular drug D04FHG
Platelet Activating Factor Small molecular drug DB02261
Rp-52770 Small molecular drug D02QUS
Sri-63-675 Small molecular drug D0WJ1N
Ur-11353 Small molecular drug D0OT3H
Ur-12519 Small molecular drug D00JJP
Veraguensin Small molecular drug D0N0IV
Etizolam . DB09166
Lau-0901 . D0HJ9U
Ur-10324 . D05MWB
Ur-12510 . D0G1AK
Discontinued
Click To Hide/Show 33 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Abt-299 Small molecular drug D07SGB
Bepafant Small molecular drug D0Y2ES
Bn 50730 Small molecular drug D0G2RE
Bn-50726 Small molecular drug D0V7HD
Bn50727 Small molecular drug D0R0TF
Bn50739 Small molecular drug D0KW2A
Cl-184005 Small molecular drug D05RBL
Cv 6209 Small molecular drug D05CEK
Dacopafant Small molecular drug D0C7LF
De-081 Small molecular drug D0CB8W
E-6123 Small molecular drug D0R0EV
Foropafant Small molecular drug D05YUK
L-659989 Small molecular drug D0MA3D
Minopafant Small molecular drug D01KZC
Mk-287 Small molecular drug D05KQE
Ro-24-0238 Small molecular drug D01RFI
Ro-24-4736 Small molecular drug D0S4JY
Sch-40338 Small molecular drug D0Q8YN
Sdz-62-434 Small molecular drug D0XQ1W
Sdz-64-412 Small molecular drug D0BD3U
Sm-10661 Small molecular drug D0U7DI
Tcv-309 Small molecular drug D04ENK
Tiapafant Small molecular drug D0Q1UR
Tulopafant Small molecular drug D0H3XB
Uk-74505 Small molecular drug D0I6UU
Web-2347 Small molecular drug D02HCU
Agn-191743 . D02DVB
Cmi-206 . D0V4GT
Df-1111301 . D0W5OV
Fr-128998 . D08EVM
Kc-11404 . D04APY
Kc-11425 . D01LXG
Ur-12460 . D09FQB

References

1 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060