Details of the Target
General Information of Target
| Target ID | LDTP03295 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cyclin-C (CCNC) | |||||
| Gene Name | CCNC | |||||
| Gene ID | 892 | |||||
| Synonyms |
Cyclin-C; SRB11 homolog; hSRB11 |
|||||
| 3D Structure | ||||||
| Sequence |
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Cyclin family, Cyclin C subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin-dependent kinase CDK8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C90(1.96) | LDD3410 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] | |
Competitor(s) Related to This Target
References




