Details of the Target
General Information of Target
| Target ID | LDTP03264 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interleukin-32 (IL32) |
|
||||
| Gene Name | IL32 | |||||
| Gene ID | 9235 | |||||
| Synonyms |
NK4; TAIF; Interleukin-32; IL-32; Natural killer cells protein 4; Tumor necrosis factor alpha-inducing factor |
|||||
| 3D Structure | ||||||
| Sequence |
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
N.A. | LDD0241 | [1] | |
|
DBIA Probe Info |
 |
C227(3.77) | LDD3331 | [2] | |
|
BTD Probe Info |
 |
C227(1.06) | LDD2092 | [3] | |
|
IA-alkyne Probe Info |
 |
C151(20.00) | LDD1707 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0548 | 1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one | MDA-MB-231 | C227(0.94) | LDD2142 | [3] |
| LDCM0519 | 1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one | MDA-MB-231 | C227(0.83) | LDD2112 | [3] |
| LDCM0022 | KB02 | T cell | C151(20.00) | LDD1707 | [4] |
| LDCM0023 | KB03 | 786-O | C227(2.93) | LDD2664 | [2] |
| LDCM0024 | KB05 | MKN-1 | C227(3.77) | LDD3331 | [2] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C227(1.06) | LDD2092 | [3] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C227(1.91) | LDD2094 | [3] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C227(1.10) | LDD2098 | [3] |
| LDCM0507 | Nucleophilic fragment 16b | MDA-MB-231 | C227(0.93) | LDD2100 | [3] |
| LDCM0511 | Nucleophilic fragment 18b | MDA-MB-231 | C227(0.76) | LDD2104 | [3] |
| LDCM0512 | Nucleophilic fragment 19a | MDA-MB-231 | C227(2.28) | LDD2105 | [3] |
| LDCM0515 | Nucleophilic fragment 20b | MDA-MB-231 | C227(0.58) | LDD2108 | [3] |
| LDCM0535 | Nucleophilic fragment 30b | MDA-MB-231 | C227(1.09) | LDD2128 | [3] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C227(1.19) | LDD2141 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Myeloblastin (PRTN3) | Peptidase S1 family | P24158 | |||
| Protein kinase C delta type (PRKCD) | AGC Ser/Thr protein kinase family | Q05655 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| CCAAT/enhancer-binding protein alpha (CEBPA) | BZIP family | P49715 | |||
References