Details of the Target
General Information of Target
| Target ID | LDTP03254 | |||||
|---|---|---|---|---|---|---|
| Target Name | Vesicle-associated membrane protein 1 (VAMP1) |
|
||||
| Gene Name | VAMP1 | |||||
| Gene ID | 6843 | |||||
| Synonyms |
SYB1; Vesicle-associated membrane protein 1; VAMP-1; Synaptobrevin-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Synaptobrevin family
|
|||||
| Subcellular location |
Single-pass type IV membrane protein; Cytoplasmic vesicle membrane; Mitochondrion outer membrane; Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane
|
|||||
| Function | Involved in the targeting and/or fusion of transport vesicles to their target membrane. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
 |
D66(0.94) | LDD2209 | [1] | |
|
OPA-S-S-alkyne Probe Info |
 |
K61(2.34); K54(3.29) | LDD3494 | [2] | |
References