Details of the Target

General Information of Target

Target ID LDTP03245
Target Name Brain-derived neurotrophic factor (BDNF)
Gene Name BDNF
Gene ID 627
Synonyms
Brain-derived neurotrophic factor; BDNF; Abrineurin) [Cleaved into: BDNF precursor form; ProBDNF)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
Target Type
Clinical trial
Target Bioclass
Other
Family
NGF-beta family
Subcellular location
Secreted
Function
Important signaling molecule that activates signaling cascades downstream of NTRK2. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.; [BDNF precursor form]: Important signaling molecule that activates signaling cascades downstream of NTRK2. Activates signaling cascades via the heterodimeric receptor formed by NGFR and SORCS2. Signaling via NGFR and SORCS2 plays a role in synaptic plasticity and long-term depression (LTD). Binding to NGFR and SORCS2 promotes neuronal apoptosis. Promotes neuronal growth cone collapse.
TTD ID
T93122
Uniprot ID
P23560
DrugMap ID
TTSMLOH
Ensemble ID
ENST00000314915.6
HGNC ID
HGNC:1033
ChEMBL ID
CHEMBL4523205

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A2780 SNV: p.E44G .
HT115 SNV: p.T240A .
IGROV1 SNV: p.E183K .
MEWO SNV: p.P188S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
1c-yne
 Probe Info  		N.A.  LDD0228  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
GTP:AMP phosphotransferase AK3, mitochondrial (AK3) Adenylate kinase family Q9UIJ7
Deoxyribonuclease-1-like 1 (DNASE1L1) DNase I family P49184
Galactoside alpha-(1,2)-fucosyltransferase 2 (FUT2) Glycosyltransferase 11 family Q10981
Dihydropyrimidinase-related protein 1 (CRMP1) Hydantoinase/dihydropyrimidinase family Q14194
Phospholipid phosphatase-related protein type 1 (PLPPR1) PA-phosphatase related phosphoesterase family Q8TBJ4
Epoxide hydrolase 1 (EPHX1) Peptidase S33 family P07099
Protein prune homolog 2 (PRUNE2) PPase class C family Q8WUY3
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA) AGC Ser/Thr protein kinase family P17612
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Cyclin-dependent kinase 5 (CDK5) CMGC Ser/Thr protein kinase family Q00535
Tyrosine-protein kinase Fyn (FYN) Tyr protein kinase family P06241
Ribose-phosphate pyrophosphokinase 1 (PRPS1) Ribose-phosphate pyrophosphokinase family P60891
Thioredoxin (TXN) Thioredoxin family P10599
BTB/POZ domain-containing protein 1 (BTBD1) . Q9H0C5
Germ cell-less protein-like 2 (GMCL2) . Q8NEA9
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-secretase subunit APH-1B (APH1B) APH-1 family Q8WW43
Amyloid-beta precursor protein (APP) APP family P05067
Lipopolysaccharide-binding protein (LBP) BPI/LBP family P18428
Choline transporter-like protein 5 (SLC44A5) CTL (choline transporter-like) family Q8NCS7
Exocyst complex component 5 (EXOC5) SEC10 family O00471
Solute carrier family 41 member 3 (SLC41A3) SLC41A transporter family Q96GZ6
Sortilin (SORT1) VPS10-related sortilin family Q99523
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A3 (HOXA3) Antp homeobox family O43365
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Advanced glycosylation end product-specific receptor (AGER) . Q15109
Other
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Annexin A4 (ANXA4) Annexin family P09525
Catenin beta-1 (CTNNB1) Beta-catenin family P35222
Hematopoietic cell signal transducer (HCST) DAP10 family Q9UBK5
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Galanin peptides (GAL) Galanin family P22466
Large ribosomal subunit protein mL49 (MRPL49) Mitochondrion-specific ribosomal protein mL49 family Q13405
Melanocortin-2 receptor accessory protein 2 (MRAP2) MRAP family Q96G30
Neurotrophin-4 (NTF4) NGF-beta family P34130
RUS family member 1 (RUSF1) RUS1 family Q96GQ5
Transducin-like enhancer protein 6 (TLE6) WD repeat Groucho/TLE family Q9H808
Coiled-coil domain-containing protein 32 (CCDC32) . Q9BV29
Cytohesin-1 (CYTH1) . Q15438

The Drug(s) Related To This Target

Approved
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Chondroitin Sulfate . DB09301
Copper . DB09130
Esketamine . DB11823
Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pym-50028 . D0M2TG
Discontinued
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cx-717 Small molecular drug DB05047

References

1 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.