Details of the Target

General Information of Target

Target ID LDTP03208
Target Name Fibulin-1 (FBLN1)
Gene Name FBLN1
Gene ID 2192
Synonyms
Fibulin-1; FIBL-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKE
CRMVQEQCCHSQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQ
AQGQSCEYSLMVGYQCGQVFQACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRC
RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
APPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
DIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINE
TCFNIQGGFRCLAFECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTV
ISLPTFREFTRPEEIIFLRAITPPHPASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVV
RQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSEYWF
Target Bioclass
Other
Family
Fibulin family
Subcellular location
Secreted, extracellular space, extracellular matrix
Function
Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.
Uniprot ID
P23142
Ensemble ID
ENST00000262722.11
HGNC ID
HGNC:3600

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
EFO27 SNV: p.R289Ter DBIA    Probe Info 
GB1 SNV: p.A317V DBIA    Probe Info 
HCT116 Deletion: p.G684AfsTer75 .
HEC1 SNV: p.E127K DBIA    Probe Info 
HEC1B SNV: p.E127K .
HT115 SNV: p.A317D; p.D525G .
IGR1 SNV: p.Q280H DBIA    Probe Info 
IGROV1 SNV: p.R521H .
MCC13 SNV: p.S687F .
MFE296 SNV: p.C143Y DBIA    Probe Info 
NCIH358 SNV: p.E444K .
NCIH716 SNV: p.G230Ter .
PF382 SNV: p.A5T .
REH SNV: p.R8H .
SAOS2 SNV: p.I263V .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
OPA-S-S-alkyne
 Probe Info  		K59(1.25); K187(2.05); K649(2.26)  LDD3494  [1]
DBIA
 Probe Info  		C186(1.99)  LDD3311  [2]
Acrolein
 Probe Info  		N.A.  LDD0221  [3]
m-APA
 Probe Info  		N.A.  LDD2231  [4]
IA-alkyne
 Probe Info  		N.A.  LDD0167  [5]
IPM
 Probe Info  		N.A.  LDD2156  [6]
TFBX
 Probe Info  		N.A.  LDD0148  [7]
Methacrolein
 Probe Info  		C403(0.00); C260(0.00)  LDD0218  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0107  IAA HeLa N.A.  LDD0221  [3]
 LDCM0022  KB02 8305C C341(2.32)  LDD2248  [2]
 LDCM0023  KB03 786-O C341(1.80)  LDD2664  [2]
 LDCM0024  KB05 G361 C186(1.99)  LDD3311  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
GTP:AMP phosphotransferase AK3, mitochondrial (AK3) Adenylate kinase family Q9UIJ7
Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase (ALG10) ALG10 glucosyltransferase family Q5BKT4
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Ataxin-3 (ATXN3) . P54252
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
Solute carrier family 66 member 2 (SLC66A2) . Q8N2U9
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Paired box protein Pax-5 (PAX5) . Q02548
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 (LINGO1) . Q96FE5
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-X-C motif chemokine 5 (CXCL5) Intercrine alpha (chemokine CxC) family P42830
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Large ribosomal subunit protein bL12m (MRPL12) Bacterial ribosomal protein bL12 family P52815
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
Keratin-associated protein 19-2 (KRTAP19-2) KRTAP type 19 family Q3LHN2
Late cornified envelope protein 1A (LCE1A) LCE family Q5T7P2
Late cornified envelope protein 1B (LCE1B) LCE family Q5T7P3
Late cornified envelope protein 1C (LCE1C) LCE family Q5T751
Late cornified envelope protein 1F (LCE1F) LCE family Q5T754
Late cornified envelope protein 3A (LCE3A) LCE family Q5TA76
Late cornified envelope protein 5A (LCE5A) LCE family Q5TCM9
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Lamin tail domain-containing protein 2 (LMNTD2) . Q8IXW0

References

1 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
6 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255