Details of the Target
General Information of Target
| Target ID | LDTP03190 | |||||
|---|---|---|---|---|---|---|
| Target Name | Solute carrier family 2, facilitated glucose transporter member 5 (SLC2A5) | |||||
| Gene Name | SLC2A5 | |||||
| Gene ID | 6518 | |||||
| Synonyms |
GLUT5; Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 |
|||||
| 3D Structure | ||||||
| Sequence |
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF GLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGW DSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLT AALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNK VSEVYPEKEELKELPPVTSEQ |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
|
|||||
| Subcellular location |
Apical cell membrane
|
|||||
| Function |
Functions as a fructose transporter that has only low activity with other monosaccharides. Can mediate the uptake of 2-deoxyglucose, but with low efficiency. Essential for fructose uptake in the small intestine. Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose. Required for the development of high blood pressure in response to high dietary fructose intake.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C118(1.46) | LDD2182 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C118(1.27) | LDD2187 | [1] |
| LDCM0573 | Fragment11 | Ramos | C118(0.69) | LDD2190 | [1] |
| LDCM0576 | Fragment14 | Ramos | C118(1.17) | LDD2193 | [1] |
| LDCM0586 | Fragment28 | Ramos | C118(3.38) | LDD2198 | [1] |
| LDCM0566 | Fragment4 | Ramos | C118(1.89) | LDD2184 | [1] |
| LDCM0569 | Fragment7 | Ramos | C118(1.67) | LDD2186 | [1] |
| LDCM0022 | KB02 | Ramos | C118(1.46) | LDD2182 | [1] |
| LDCM0023 | KB03 | Ramos | C118(1.72) | LDD2183 | [1] |
| LDCM0024 | KB05 | Ramos | C118(1.06) | LDD2185 | [1] |

