Details of the Target
General Information of Target
| Target ID | LDTP03121 | |||||
|---|---|---|---|---|---|---|
| Target Name | Diamine acetyltransferase 1 (SAT1) | |||||
| Gene Name | SAT1 | |||||
| Gene ID | 6303 | |||||
| Synonyms |
SAT; Diamine acetyltransferase 1; EC 2.3.1.57; Polyamine N-acetyltransferase 1; Putrescine acetyltransferase; Spermidine/spermine N(1)-acetyltransferase 1; SSAT; SSAT-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Acetyltransferase family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Also acts on 1,3-diaminopropane and 1,5-diaminopentane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C14(1.84) | LDD3407 | [1] | |
Competitor(s) Related to This Target