General Information of Target

Target ID LDTP03096
Target Name T-cell surface glycoprotein CD3 zeta chain (CD247)
Gene Name CD247
Gene ID 919
Synonyms
CD3Z; T3Z; TCRZ; T-cell surface glycoprotein CD3 zeta chain; T-cell receptor T3 zeta chain; CD antigen CD247
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Target Bioclass
Transporter and channel
Family
CD3Z/FCER1G family
Subcellular location
Cell membrane
Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Uniprot ID
P20963
Ensemble ID
ENST00000362089.10
HGNC ID
HGNC:1677

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
Ishikawa (Heraklio) 02 ER SNV: p.S56N .
MDST8 SNV: p.G140S .
SUPT1 SNV: p.G127E .
SW1990 SNV: p.D139N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info 
Y142(12.93)  LDD0260  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tyrosine-protein kinase ZAP-70 (ZAP70) Tyr protein kinase family P43403
Tyrosine-protein phosphatase non-receptor type 22 (PTPN22) Protein-tyrosine phosphatase family Q9Y2R2
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beta-arrestin-1 (ARRB1) Arrestin family P49407
T-cell surface glycoprotein CD3 zeta chain (CD247) CD3Z/FCER1G family P20963
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SH2 domain-containing protein 1A (SH2D1A) . O60880
SH2/SH3 adapter protein NCK1 (NCK1) . P16333

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Muromonab BiotechDrug DB00075
Teclistamab . DB16655
Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Odronextamab . DB16684

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.