Details of the Target
General Information of Target
| Target ID | LDTP03069 | |||||
|---|---|---|---|---|---|---|
| Target Name | Granzyme H (GZMH) | |||||
| Gene Name | GZMH | |||||
| Gene ID | 2999 | |||||
| Synonyms |
CGL2; CTSGL2; Granzyme H; EC 3.4.21.-; CCP-X; Cathepsin G-like 2; CTSGL2; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C; CSP-C |
|||||
| 3D Structure | ||||||
| Sequence |
MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVL
TAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKW TTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNY SRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIK RTMKRL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase S1 family, Granzyme subfamily
|
|||||
| Subcellular location |
Cytolytic granule
|
|||||
| Function |
Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C170, C172(8.16) | LDD1705 | [1] | |
Competitor(s) Related to This Target

