Details of the Target
General Information of Target
| Target ID | LDTP03041 | |||||
|---|---|---|---|---|---|---|
| Target Name | POU domain, class 3, transcription factor 2 (POU3F2) | |||||
| Gene Name | POU3F2 | |||||
| Gene ID | 5454 | |||||
| Synonyms |
BRN2; OCT7; OTF7; POU domain, class 3, transcription factor 2; Brain-specific homeobox/POU domain protein 2; Brain-2; Brn-2; Nervous system-specific octamer-binding transcription factor N-Oct-3; Octamer-binding protein 7; Oct-7; Octamer-binding transcription factor 7; OTF-7
|
|||||
| 3D Structure | ||||||
| Sequence |
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP GAEDVYGGSRDTPPHHGVQTPVQ |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
POU transcription factor family, Class-3 subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that plays a key role in neuronal differentiation. Binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a non-conserved spacer region of 0, 2, or 3 nucleotides. Acts as a transcriptional activator when binding cooperatively with SOX4, SOX11, or SOX12 to gene promoters. The combination of three transcription factors, ASCL1, POU3F2/BRN2 and MYT1L, is sufficient to reprogram fibroblasts and other somatic cells into induced neuronal (iN) cells in vitro. Acts downstream of ASCL1, accessing chromatin that has been opened by ASCL1, and promotes transcription of neuronal genes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C361(1.53) | LDD3413 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [2] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Histone acetyltransferase p300 (EP300) | . | Q09472 | |||
Transcription factor
References



