Details of the Target
General Information of Target
| Target ID | LDTP02987 | |||||
|---|---|---|---|---|---|---|
| Target Name | Troponin I, slow skeletal muscle (TNNI1) | |||||
| Gene Name | TNNI1 | |||||
| Gene ID | 7135 | |||||
| Synonyms |
Troponin I, slow skeletal muscle; Troponin I, slow-twitch isoform |
|||||
| 3D Structure | ||||||
| Sequence |
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSA DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA AKSPTSQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Troponin I family
|
|||||
| Function | Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C87(3.31); C29(1.73) | LDD3401 | [1] | |
Competitor(s) Related to This Target