Details of the Target
General Information of Target
| Target ID | LDTP02947 | |||||
|---|---|---|---|---|---|---|
| Target Name | Glutathione peroxidase 2 (GPX2) | |||||
| Gene Name | GPX2 | |||||
| Gene ID | 2877 | |||||
| Synonyms |
Glutathione peroxidase 2; GPx-2; GSHPx-2; EC 1.11.1.9; Gastrointestinal glutathione peroxidase; Glutathione peroxidase-gastrointestinal; GPx-GI; GSHPx-GI; Glutathione peroxidase-related protein 2; GPRP-2; Phospholipid hydroperoxide glutathione peroxidase GPX2; EC 1.11.1.12
|
|||||
| 3D Structure | ||||||
| Sequence |
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP DIKRLLKVAI |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glutathione peroxidase family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis. Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl hydroperoxide, as well as several fatty acid-derived hydroperoxides. Cannot reduce phosphatidycholine hydroperoxide.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
 |
100.00 | LDD0444 | [1] | |
|
IPM Probe Info |
 |
N.A. | LDD0241 | [2] | |
|
DBIA Probe Info |
 |
C55(1.22) | LDD3344 | [3] | |
|
IA-alkyne Probe Info |
 |
C55(0.00); C105(0.00); C68(0.00) | LDD0162 | [4] | |
|
W1 Probe Info |
 |
N.A. | LDD0236 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References