Details of the Target
General Information of Target
| Target ID | LDTP02903 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription factor JunD (JUND) | |||||
| Gene Name | JUND | |||||
| Gene ID | 3727 | |||||
| Synonyms |
Transcription factor JunD; Transcription factor AP-1 subunit JunD |
|||||
| 3D Structure | ||||||
| Sequence |
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, Jun subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor binding AP-1 sites. Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' and enhancing their transcriptional activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
DBIA Probe Info |
![]() |
C336(1.84) | LDD3358 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD2242 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [4] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase Mdm2 (MDM2) | MDM2/MDM4 family | Q00987 | |||
| Mitogen-activated protein kinase 10 (MAPK10) | CMGC Ser/Thr protein kinase family | P53779 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amyloid-beta precursor protein (APP) | APP family | P05067 | |||
Transcription factor
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-dependent transcription factor ATF-2 (ATF2) | BZIP family | P15336 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Actin-related protein 3 (ACTR3) | Actin family | P61158 | |||
References






