Details of the Target

General Information of Target

Target ID LDTP02838
Target Name Platelet endothelial cell adhesion molecule (PECAM1)
Gene Name PECAM1
Gene ID 5175
Synonyms
Platelet endothelial cell adhesion molecule; PECAM-1; EndoCAM; GPIIA'; PECA1; CD antigen CD31
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT
Target Type
Literature-reported
Target Bioclass
Immunoglobulin
Subcellular location
Cell membrane; Cell junction
Function
Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions. Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC) and is also essential for the LBRC membrane to be targeted around migrating leukocytes. Trans-homophilic interaction may play a role in endothelial cell-cell adhesion via cell junctions. Heterophilic interaction with CD177 plays a role in transendothelial migration of neutrophils. Homophilic ligation of PECAM1 prevents macrophage-mediated phagocytosis of neighboring viable leukocytes by transmitting a detachment signal. Promotes macrophage-mediated phagocytosis of apoptotic leukocytes by tethering them to the phagocytic cells; PECAM1-mediated detachment signal appears to be disabled in apoptotic leukocytes. Modulates bradykinin receptor BDKRB2 activation. Regulates bradykinin- and hyperosmotic shock-induced ERK1/2 activation in endothelial cells. Induces susceptibility to atherosclerosis.; [Isoform Delta15]: Does not protect against apoptosis.
TTD ID
T89056
Uniprot ID
P16284
DrugMap ID
TT4EZB2
Ensemble ID
ENST00000563924.6
HGNC ID
HGNC:8823

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.P69S .
JURKAT SNV: p.Q56Ter .
MFE296 SNV: p.P194S .
PFSK1 SNV: p.T235I .
RD SNV: p.V503F .
SKMEL3 SNV: p.G14Ter .
SUDHL6 SNV: p.K621R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C572(2.60)  LDD3334  [1]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [2]
IA-alkyne
 Probe Info  		C572(0.00); C386(0.00); C109(0.00)  LDD0036  [2]
Lodoacetamide azide
 Probe Info  		C109(0.00); C523(0.00)  LDD0037  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0281  AC21 HEK-293T C109(1.04)  LDD1520  [3]
 LDCM0289  AC29 HEK-293T C109(0.91)  LDD1528  [3]
 LDCM0298  AC37 HEK-293T C109(1.12)  LDD1537  [3]
 LDCM0307  AC45 HEK-293T C109(0.96)  LDD1546  [3]
 LDCM0312  AC5 HEK-293T C109(0.67)  LDD1551  [3]
 LDCM0316  AC53 HEK-293T C109(1.06)  LDD1555  [3]
 LDCM0325  AC61 HEK-293T C109(0.98)  LDD1564  [3]
 LDCM0248  AKOS034007472 HEK-293T C109(0.97)  LDD1511  [3]
 LDCM0409  CL21 HEK-293T C109(1.23)  LDD1613  [3]
 LDCM0422  CL33 HEK-293T C109(0.82)  LDD1626  [3]
 LDCM0435  CL45 HEK-293T C109(2.06)  LDD1639  [3]
 LDCM0448  CL57 HEK-293T C109(1.35)  LDD1651  [3]
 LDCM0461  CL69 HEK-293T C109(1.39)  LDD1664  [3]
 LDCM0475  CL81 HEK-293T C109(0.70)  LDD1678  [3]
 LDCM0484  CL9 HEK-293T C109(1.09)  LDD1687  [3]
 LDCM0488  CL93 HEK-293T C109(1.21)  LDD1691  [3]
 LDCM0022  KB02 A2780 C572(1.99); C405(1.07)  LDD2254  [1]
 LDCM0023  KB03 CMK C572(3.59)  LDD2719  [1]
 LDCM0024  KB05 MOLM-16 C572(2.60)  LDD3334  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adenylate kinase 2, mitochondrial (AK2) Adenylate kinase family P54819
Deoxyribonuclease-1-like 1 (DNASE1L1) DNase I family P49184
Eyes absent homolog 3 (EYA3) EYA family Q99504
Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1) Isocitrate and isopropylmalate dehydrogenases family O75874
Phospholipid phosphatase-related protein type 1 (PLPPR1) PA-phosphatase related phosphoesterase family Q8TBJ4
Proprotein convertase subtilisin/kexin type 7 (PCSK7) Peptidase S8 family Q16549
Protein prune homolog 2 (PRUNE2) PPase class C family Q8WUY3
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Serine/threonine-protein kinase PAK 5 (PAK5) STE Ser/Thr protein kinase family Q9P286
Proto-oncogene tyrosine-protein kinase Src (SRC) Tyr protein kinase family P12931
Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) Protein-tyrosine phosphatase family Q06124
Tyrosine-protein phosphatase non-receptor type 6 (PTPN6) Protein-tyrosine phosphatase family P29350
SPRY domain-containing SOCS box protein 1 (SPSB1) SPSB family Q96BD6
SPRY domain-containing SOCS box protein 2 (SPSB2) SPSB family Q99619
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A (STT3A) STT3 family P46977
Acyl-coenzyme A thioesterase THEM4 (THEM4) THEM4/THEM5 thioesterase family Q5T1C6
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-related ovarian killer protein (BOK) Bcl-2 family Q9UMX3
Choline transporter-like protein 5 (SLC44A5) CTL (choline transporter-like) family Q8NCS7
Major facilitator superfamily domain-containing protein 10 (MFSD10) Major facilitator superfamily Q14728
Transmembrane channel-like protein 6 (TMC6) TMC family Q7Z403
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock transcription factor, Y-linked (HSFY1; HSFY2) HSF family Q96LI6
Zinc finger and BTB domain-containing protein 49 (ZBTB49) Krueppel C2H2-type zinc-finger protein family Q6ZSB9
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Achaete-scute homolog 4 (ASCL4) . Q6XD76
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptide FF receptor 1 (NPFFR1) G-protein coupled receptor 1 family Q9GZQ6
Other
Click To Hide/Show 35 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Junction plakoglobin (JUP) Beta-catenin family P14923
CCR4-NOT transcription complex subunit 3 (CNOT3) CNOT2/3/5 family O75175
DNA damage-inducible transcript 4 protein (DDIT4) DDIT4 family Q9NX09
Epithelial splicing regulatory protein 1 (ESRP1) ESRP family Q6NXG1
Large ribosomal subunit protein eL43 (RPL37A) Eukaryotic ribosomal protein eL43 family P61513
Protein FAM163A (FAM163A) FAM163 family Q96GL9
Protein INCA1 (INCA1) INCA family Q0VD86
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Syncoilin (SYNC) Intermediate filament family Q9H7C4
Ragulator complex protein LAMTOR1 (LAMTOR1) LAMTOR1 family Q6IAA8
Cytosolic iron-sulfur assembly component 2B (CIAO2B) MIP18 family Q9Y3D0
Large ribosomal subunit protein mL49 (MRPL49) Mitochondrion-specific ribosomal protein mL49 family Q13405
Paraneoplastic antigen-like protein 5 (PNMA5) PNMA family Q96PV4
Ski-like protein (SKIL) SKI family P12757
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1) SNF5 family Q12824
Spermatogenesis-associated protein 2-like protein (SPATA2L) SPATA2 family Q8IUW3
Protein spire homolog 1 (SPIRE1) Spire family Q08AE8
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Protein VAC14 homolog (VAC14) VAC14 family Q08AM6
Vacuolar protein sorting-associated protein 11 homolog (VPS11) VPS11 family Q9H270
POC1 centriolar protein homolog A (POC1A) WD repeat POC1 family Q8NBT0
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Epidermal growth factor-like protein 8 (EGFL8) . Q99944
Fanconi anemia group G protein (FANCG) . O15287
Galectin-1 (LGALS1) . P09382
Killer cell lectin-like receptor subfamily G member 1 (KLRG1) . Q96E93
mRNA decay activator protein ZFP36 (ZFP36) . P26651
Netrin-4 (NTN4) . Q9HB63
Regulating synaptic membrane exocytosis protein 3 (RIMS3) . Q9UJD0
SERPINE1 mRNA-binding protein 1 (SERBP1) . Q8NC51
Splicing factor 45 (RBM17) . Q96I25
Telethonin (TCAP) . O15273
TP53-binding protein 1 (TP53BP1) . Q12888
Uncharacterized protein KIAA0408 (KIAA0408) . Q6ZU52
WD repeat-containing protein 44 (WDR44) . Q5JSH3

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402