Details of the Target
General Information of Target
| Target ID | LDTP02781 | |||||
|---|---|---|---|---|---|---|
| Target Name | Folate receptor alpha (FOLR1) |
|
||||
| Gene Name | FOLR1 | |||||
| Gene ID | 2348 | |||||
| Synonyms |
FOLR; Folate receptor alpha; FR-alpha; Adult folate-binding protein; FBP; Folate receptor 1; Folate receptor, adult; KB cells FBP; Ovarian tumor-associated antigen MOv18 |
|||||
| 3D Structure | ||||||
| Sequence |
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA AWPFLLSLALMLLWLLS |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Folate receptor family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells . Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
OPA-S-S-alkyne Probe Info |
 |
K41(1.41); K44(1.80); K76(3.42); K97(4.12) | LDD3494 | [1] | |
|
DBIA Probe Info |
 |
C135(1.01) | LDD3313 | [2] | |
|
TFBX Probe Info |
 |
N.A. | LDD0027 | [3] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0217 | [4] | |
|
Crotonaldehyde Probe Info |
 |
N.A. | LDD0219 | [4] | |
|
Methacrolein Probe Info |
 |
C37(0.00); C139(0.00); C146(0.00) | LDD0218 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | C37(0.00); C135(0.00); C209(0.00); C152(0.00) | LDD0222 | [4] |
| LDCM0107 | IAA | HeLa | C135(0.00); C139(0.00); C146(0.00); C96(0.00) | LDD0221 | [4] |
| LDCM0022 | KB02 | A2780 | C135(0.99) | LDD2254 | [2] |
| LDCM0023 | KB03 | ABC-1 | C135(3.14) | LDD2679 | [2] |
| LDCM0024 | KB05 | Hs 936.T | C135(1.01) | LDD3313 | [2] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0226 | [4] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Solute carrier family 35 member F6 (SLC35F6) | SLC35F solute transporter family | Q8N357 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Folic Acid | Small molecular drug | DB00158 | |||
| Methotrexate | Small molecular drug | DB00563 | |||
| Pyrimethamine | Small molecular drug | D0C0SK | |||
| Pafolacianine | . | DB15413 | |||
Phase 3
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Farletuzumab | Monoclonal antibody | D06XVN | |||
| Ec20 | Small molecular drug | D00BHL | |||
| Mirvetuximab Soravtansine | . | D0RP2W | |||
| Mk-8109 | . | D02TJT | |||
Phase 2
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Bms-753493 | Small molecular drug | D0N2GC | |||
| Folateimmune | Small molecular drug | D0N8JG | |||
| Talotrexin | Small molecular drug | D0GL7H | |||
| Ec-145 | . | D09JGH | |||
Phase 1
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Stro-002 | Antibody drug conjugate | D10GPJ | |||
| Ec0489 | Small molecular drug | D06CVN | |||
| Imgn-853 | . | D07DPC | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Vintafolide | . | DB05168 | |||
References