Details of the Target
General Information of Target
| Target ID | LDTP02763 | |||||
|---|---|---|---|---|---|---|
| Target Name | Fatty acid-binding protein, adipocyte (FABP4) | |||||
| Gene Name | FABP4 | |||||
| Gene ID | 2167 | |||||
| Synonyms |
Fatty acid-binding protein, adipocyte; Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM KGVTSTRVYERA |
|||||
| Target Type |
Patented-recorded
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Calycin superfamily, Fatty-acid binding protein (FABP) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C118(8.62) | LDD3345 | [1] | |
Competitor(s) Related to This Target