Details of the Target
General Information of Target
| Target ID | LDTP02726 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sodium/potassium-transporting ATPase subunit beta-2 (ATP1B2) | |||||
| Gene Name | ATP1B2 | |||||
| Gene ID | 482 | |||||
| Synonyms |
Sodium/potassium-transporting ATPase subunit beta-2; Adhesion molecule in glia; AMOG; Sodium/potassium-dependent ATPase subunit beta-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFI KMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYT QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
X(+)/potassium ATPases subunit beta family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known.; Mediates cell adhesion of neurons and astrocytes, and promotes neurite outgrowth.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C129(2.06); C10(4.22) | LDD2469 | [1] | |
|
IPM Probe Info |
 |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References