Details of the Target
General Information of Target
Target ID | LDTP02660 | |||||
---|---|---|---|---|---|---|
Target Name | C-C motif chemokine 5 (CCL5) | |||||
Gene Name | CCL5 | |||||
Gene ID | 6352 | |||||
Synonyms |
D17S136E; SCYA5; C-C motif chemokine 5; EoCP; Eosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5; T cell-specific protein P228; TCP228; T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68; RANTES(4-68)]
|
|||||
3D Structure | ||||||
Sequence |
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS |
|||||
Target Type |
Clinical trial
|
|||||
Target Bioclass |
Cytokine and receptor
|
|||||
Family |
Intercrine beta (chemokine CC) family
|
|||||
Subcellular location |
Secreted
|
|||||
Function |
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C73(3.07) | LDD3411 | [1] |
Competitor(s) Related to This Target