Details of the Target
General Information of Target
| Target ID | LDTP02628 | |||||
|---|---|---|---|---|---|---|
| Target Name | Eosinophil cationic protein (RNASE3) | |||||
| Gene Name | RNASE3 | |||||
| Gene ID | 6037 | |||||
| Synonyms |
ECP; RNS3; Eosinophil cationic protein; ECP; EC 3.1.27.-; Ribonuclease 3; RNase 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Pancreatic ribonuclease family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E.coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C138(0.27) | LDD2236 | [1] | |

