Details of the Target
General Information of Target
| Target ID | LDTP02597 | |||||
|---|---|---|---|---|---|---|
| Target Name | Immunoglobulin iota chain (VPREB1) | |||||
| Gene Name | VPREB1 | |||||
| Gene ID | 7441 | |||||
| Synonyms |
VPREB; Immunoglobulin iota chain; CD179 antigen-like family member A; Protein VPreB1; V(pre)B protein; VpreB protein; CD antigen CD179a |
|||||
| 3D Structure | ||||||
| Sequence |
MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR
PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR SSEKEEREREWEEEMEPTAARTRVP |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Family |
Immunoglobulin superfamily
|
|||||
| Subcellular location |
Endoplasmic reticulum
|
|||||
| Function |
Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C115(1.19) | LDD3403 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [2] | |
Competitor(s) Related to This Target
References


