Details of the Target

General Information of Target

Target ID LDTP02578
Target Name Aromatase (CYP19A1)
Gene Name CYP19A1
Gene ID 1588
Synonyms
ARO1; CYAR; CYP19; Aromatase; EC 1.14.14.14; CYPXIX; Cytochrome P-450AROM; Cytochrome P450 19A1; Estrogen synthase
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Target Type
Successful
Target Bioclass
Enzyme
Family
Cytochrome P450 family
Subcellular location
Endoplasmic reticulum membrane
Function
A cytochrome P450 monooxygenase that catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively. Catalyzes three successive oxidations of C19 androgens: two conventional oxidations at C19 yielding 19-hydroxy and 19-oxo/19-aldehyde derivatives, followed by a third oxidative aromatization step that involves C1-beta hydrogen abstraction combined with cleavage of the C10-C19 bond to yield a phenolic A ring and formic acid. Alternatively, the third oxidative reaction yields a 19-norsteroid and formic acid. Converts dihydrotestosterone to delta1,10-dehydro 19-nordihydrotestosterone and may play a role in homeostasis of this potent androgen. Also displays 2-hydroxylase activity toward estrone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
TTD ID
T13260
Uniprot ID
P11511
DrugMap ID
TTSZLWK
Ensemble ID
ENST00000396402.6
HGNC ID
HGNC:2594
ChEMBL ID
CHEMBL1978

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AGS SNV: p.E129A .
CAL51 SNV: p.W39Ter .
HCT15 SNV: p.H111N .
HT1376 SNV: p.L95F .
OE33 SNV: p.F406C .
SUPT1 SNV: p.R375H .
SW1271 SNV: p.M356I .
SW948 SNV: p.E489Ter .
TOV21G SNV: p.M160I .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD0241  [1]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved
Click To Hide/Show 37 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Buserelin BiotechDrug DB06719
Aminoglutethimide Small molecular drug D0M6DO
Anastrozole Small molecular drug D0W0BF
Betamethasone Small molecular drug DB00443
Bifonazole Small molecular drug DB04794
Carbimazole Small molecular drug DB00389
Cyproterone Acetate Small molecular drug DB04839
Danazol Small molecular drug DB01406
Diethylstilbestrol Small molecular drug DB00255
Econazole Small molecular drug DB01127
Estradiol Small molecular drug DB00783
Estrone Small molecular drug DB00655
Exemestane Small molecular drug D0D2VS
Fadrozole Small molecular drug D0ZX1P
Ketoconazole Small molecular drug DB01026
Letrozole Small molecular drug D0C1WH
Mefloquine Small molecular drug DB00358
Melatonin Small molecular drug DB01065
Methadone Small molecular drug DB00333
Methyltestosterone Small molecular drug DB06710
Miconazole Small molecular drug DB01110
Nandrolone Decanoate Small molecular drug DB08804
Nicotine Small molecular drug DB00184
Paclitaxel Small molecular drug DB01229
Raloxifene Small molecular drug DB00481
Sulfathiazole Small molecular drug DB06147
Tamoxifen Small molecular drug DB00675
Testolactone Small molecular drug D0C7JF
Testosterone Small molecular drug DB00624
Testosterone Undecanoate Small molecular drug DB13946
Tioconazole Small molecular drug DB01007
Troglitazone Small molecular drug DB00197
Levoketoconazole . DB05667
Mitapivat . DB16236
Norgestrel . DB09389
Testosterone Cypionate . DB13943
Testosterone Enanthate . DB13944
Phase 3
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Liarozole Small molecular drug D08UGX
Atamestane + Toremifene . D0B4ES
Phase 2
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Coumate Small molecular drug D0Y6OA
Dextromethorphan+quinidine Small molecular drug D0J8RR
Bgs-649 . D02XMD
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Naringenin Small molecular drug D02ABO
Investigative
Click To Hide/Show 227 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(2s)-5,7,2',4'-tetrahydroxyflavanone Small molecular drug D09XKH
(2s)-abyssinone Ii Small molecular drug D0NH6T
(2s)-euchrenone A7 Small molecular drug D09OPA
1-(1-benzyl-2-biphenyl-4-yl-ethyl)-1h-imidazole Small molecular drug D0D7GG
1-(2-(Benzo[B]Thiophen-4-yl)Ethyl)-1h-imidazole Small molecular drug D01IJX
1-(2-phenoxybenzyl)-1h-imidazole Small molecular drug D08TKB
1-(3-(4-fluorophenyl)Propyl)-1h-imidazole Small molecular drug D0D0DR
1-(3-methoxy-naphthalen-2-yl)-1h-imidazole Small molecular drug D03KLN
1-(4-aminophenyl)-2-(1h-imidazol-1-yl)Ethanone Small molecular drug D0XS6T
1-(4-nitro-2-phenoxybenzyl)-1h-imidazole Small molecular drug D0V3MV
1-(4-nitro-2-phenylsulfanylbenzyl)-1h-imidazole Small molecular drug D0F4WQ
1-(7-methoxy-2-phenyl-chroman-4-yl)-1h-imidazole Small molecular drug D0S0OV
1-(9-phenyl-9h-fluoren-9-yl)-1h-1,2,4-triazole Small molecular drug D0GL0L
1-(9-phenyl-9h-fluoren-9-yl)1h-imidazole Small molecular drug D02SIT
1-(9h-fluoren-9-yl)-1h-imidazole Small molecular drug D07TIJ
1-(Biphenyl-3-ylmethyl)-1h-1,2,4-triazole Small molecular drug D0I5PY
1-bromo-4-imidazol-1-ylmethyl-xanthen-9-one Small molecular drug D07PHV
1-ethyl-5-(Imidazol-1-yl-phenyl-methyl)-1h-indole Small molecular drug D06FHE
1-imidazol-1-ylmethyl-4-nitro-xanthen-9-one Small molecular drug D07CTI
1-imidazol-1-ylmethylxanthen-9-one Small molecular drug D01SZX
1-naphthalen-2-yl-1h-imidazole Small molecular drug D0G6QL
1-[(7-fluoronaphth-2-yl)Methyl]-1h-imidazole Small molecular drug D0P3ND
10-epi-8-deoxy-cumambrin B Small molecular drug D0C3XU
11beta,13-dihydro-10-epi-8-deoxycumam-brin B Small molecular drug D04TBB
2,3,4-trimethoxy-4'-amino-trans-stilbene Small molecular drug D0K5GG
2,3,5-trimethoxy-4'-amino-trans-stilbene Small molecular drug D0G2JV
2,3-dimethoxy-4'-amino-trans-stilbene Small molecular drug D0F4MF
2,4-dimethoxy-3'-amino-trans-stilbene Small molecular drug D0A7PA
2,4-dimethoxy-4'-amino-trans-stilbene Small molecular drug D0I1SI
2,5-dimethoxy-4'-amino-trans-stilbene Small molecular drug D0W7GU
2-(1h-imidazol-1-yl)-1-(4-nitrophenyl)Ethanone Small molecular drug D08UQH
2-(3-hydroxyphenyl)-7-methoxychroman-4-one Small molecular drug D0B8PE
2-(4-hydroxyphenyl)-7-methoxychroman-4-one Small molecular drug D0W3LM
2-imidazol-1-yl-7-methoxy-3-phenyl-chromen-4-one Small molecular drug D0W4IB
2-imidazol-1-ylmethylxanthen-9-one Small molecular drug D0AW7Q
2-methoxyestradiol Small molecular drug DB02342
2-phenyl-2,3-dihydrobenzo[H]Chromen-4-one"] Small molecular drug D08FOJ
2-phenyl-3-pyridin-4-ylmethylene-chroman-4-one Small molecular drug D07FGX
2-phenyl-4-[1,2,4]Triazol-1-yl-chroman-7-ol Small molecular drug D0O0BL
3,4'-(Ethane-1,2-diyl)Dibenzenamine Small molecular drug D08KLN
3,4,5-trimethoxy-3'-amino-trans-stilbene Small molecular drug D0NB8V
3,4,5-trimethoxy-4'-amino-trans-stilbene Small molecular drug D09MQF
3,4-bis(3,4-dimethoxyphenyl)Furan-2(5h)-one Small molecular drug D07JKK
3,4-dimethoxy-4'-amino-trans-stilbene Small molecular drug D0T0CK
3,5-diacetoxy-4'-amino-trans-stilbene Small molecular drug D0S7VY
3,5-diamino-4'-amino-trans-stilbene Small molecular drug D03FBI
3,5-dihydroxyl-4'-amino-trans-stilbene Small molecular drug D0J4VR
3,5-dimethoxy-4'-amino-trans-stilbene Small molecular drug D0Q8UZ
3-((1h-imidazol-1-yl)Methyl)-9h-xanthen-9-one Small molecular drug D04WJN
3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine Small molecular drug D0MA9G
3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine Small molecular drug D0K5KG
3-(2,2-diphenyl-vinyl)-pyridine Small molecular drug D02XTS
3-(3,4-dihydronaphthalen-2-yl)Pyridine Small molecular drug D0I5NW
3-(3-methyl-3,4-dihydronaphthalen-2-yl)Pyridine Small molecular drug D08HPU
3-(4-amino-phenyl)-1-methyl-pyrrolidine-2,5-dione Small molecular drug D01MPK
3-(4-amino-phenyl)-3-butyl-piperidine-2,6-dione Small molecular drug D0B5MZ
3-(4-amino-phenyl)-3-ethyl-pyrrolidine-2,5-dione Small molecular drug D0Z1OI
3-(4-amino-phenyl)-3-heptyl-piperidine-2,6-dione Small molecular drug D0E2RV
3-(4-amino-phenyl)-3-hexyl-piperidine-2,6-dione Small molecular drug D0O1ZM
3-(4-amino-phenyl)-3-methyl-pyrrolidine-2,5-dione Small molecular drug D05HRP
3-(4-amino-phenyl)-3-pentyl-piperidine-2,6-dione Small molecular drug D0A2GB
3-(4-amino-phenyl)-3-propyl-piperidine-2,6-dione Small molecular drug D0AM2Z
3-(4-amino-phenyl)-pyrrolidine-2,5-dione Small molecular drug D0H1LK
3-(4-methyl-3,4-dihydronaphthalen-2-yl)Pyridine Small molecular drug D0X1QS
3-(5-bromo-6-methoxy-naphthalen-2-yl)-pyridine Small molecular drug D04IBH
3-(5-chloro-6-methoxy-naphthalen-2-yl)-pyridine Small molecular drug D08ZTZ
3-(6-ethoxy-naphthalen-2-yl)-pyridine Small molecular drug D0R0TE
3-(6-methoxy-3,4-dihydronaphthalen-2-yl)Pyridine Small molecular drug D0NX0M
3-(6-methoxynaphthalen-2-yl)Pyridine Small molecular drug D0N1PQ
3-(Imidazolylmethyl)-4'-methoxyflavone Small molecular drug D00BVP
3-(Imidazolylmethyl)-4'-nitroflavone Small molecular drug D08EZA
3-(Imidazolylmethyl)-7-methoxy-4'-nitroflavone Small molecular drug D04VRY
3-(Imidazolylmethyl)Flavone Small molecular drug D07SOM
3-(Naphthalen-2-yl)Pyridine Small molecular drug D08FAB
3-amino-4'-amino-trans-stilbene Small molecular drug D0Q6XB
3-fluoren-9-ylidenemethyl-pyridine Small molecular drug D00GCK
3-fluoro-4'-(Pyridin-4-ylmethyl)Biphenyl-4-ol Small molecular drug D0Q0BK
3-indan-(1e)-ylidenemethyl-pyridine Small molecular drug D01SUE
3-indan-(1z)-ylidenemethyl-pyridine Small molecular drug D07PYC
3-methoxyl-4'-amino-trans-stilbene Small molecular drug D07UVN
3-nitro-4'-nitro-trans-stilbene Small molecular drug D0J8FS
3-[3-methyl-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0TM4K
3-[3-methyl-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D02BWQ
3-[3-phenyl-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0Y0CT
3-[4-chloro-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0V3YH
3-[4-chloro-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D05MQE
3-[4-fluoro-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D04QPK
3-[4-fluoro-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0L1JF
3-[4-methyl-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D04CLL
3-[4-methyl-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0AH1B
3-[5-bromo-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D08AZK
3-[5-bromo-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0U7RR
3-[5-chloro-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D02NAG
3-[5-chloro-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D04ELJ
3-[5-ethoxy-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0N9PY
3-[5-ethoxy-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0Q3JZ
3-[5-fluoro-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0V8CR
3-[5-fluoro-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0M7FS
3-[5-methoxy-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D09YXV
3-[5-methoxy-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D08PNF
3-[6-methoxy-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D00VUO
3-[6-methyl-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0AY4E
3-[6-methyl-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0Y7RB
3-[7-methoxy-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0YS2F
4'-(Pyridin-4-ylmethyl)Biphenyl-3,4-diol Small molecular drug D01REI
4'-(Pyridin-4-ylmethyl)Biphenyl-3-amine Small molecular drug D0WN9P
4'-bromo-3-(Imidazolylmethyl)-7-methoxyflavone Small molecular drug D06WPP
4'-bromo-3-(Imidazolylmethyl)Flavone Small molecular drug D09ZHX
4'-cyano-3-(Imidazolylmethyl)-7-methoxyflavone Small molecular drug D05PXK
4'-cyano-3-(Imidazolylmethyl)Flavone Small molecular drug D0CR6B
4-((1h-imidazol-1-yl)Methyl)-2h-chromen-2-one Small molecular drug D0M5EW
4-(1-imidazol-1-yl-vinyl)-benzonitrile Small molecular drug D0N7QV
4-(2,2-diphenyl-vinyl)-pyridine Small molecular drug D0Z4GR
4-(2-(1h-imidazol-1-yl)Ethoxy)-2h-chromen-2-one Small molecular drug D0U6NJ
4-(3,4,5-trimethoxyphenethyl)Aniline Small molecular drug D04HVL
4-(3,4-dimethoxyphenethyl)Aniline Small molecular drug D0O6ZM
4-(3,5-dimethoxyphenethyl)Benzenamine Small molecular drug D0WK9Q
4-androstene-3-17-dione Small molecular drug D0M8RO
4-bromo-1-imidazol-1-ylmethyl-xanthen-9-one Small molecular drug D07IQG
4-fluoren-9-ylidenemethyl-pyridine Small molecular drug D04IJE
4-imidazol-1-yl-2-phenyl-chroman-7-ol Small molecular drug D0J3PK
4-imidazol-1-ylmethyl-1-nitro-xanthen-9-one Small molecular drug D01LOU
4-imidazol-1-ylmethyl-1-nitrothioxanthen-9-one Small molecular drug D0W9ZC
4-imidazol-1-ylmethyl-2-nitroxanthen-9-one Small molecular drug D0HC9U
4-imidazol-1-ylmethyl-3-nitroxanthen-9-one Small molecular drug D0K5JU
4-imidazol-1-ylmethylthioxanthen-9-one Small molecular drug D0I2UE
4-imidazol-1-ylmethylxanthen-9-one Small molecular drug D0F5AC
4-indan-(1e)-ylidenemethyl-pyridine Small molecular drug D05YNW
4-indan-(1z)-ylidenemethyl-pyridine Small molecular drug D02CSU
4-[(3'-hydroxybiphenyl-4-yl)Methyl]Pyridine Small molecular drug D0I1YH
4-[(4'-hydroxybiphenyl-4-yl)Methyl]Pyridine Small molecular drug D03EXD
4-[5-bromo-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0D9FR
4-[5-chloro-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0YD9J
4-[5-chloro-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0F5YU
4-[5-fluoro-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D03MKT
4-[5-fluoro-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D09HOE
4-[5-methoxy-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D09HGK
4-[5-methoxy-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D07ZYL
4-[6-methoxy-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0K3CE
4-[6-methoxy-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D0J2WW
4-[6-methyl-indan-(1e)-ylidenemethyl]-pyridine Small molecular drug D0D8GU
4-[6-methyl-indan-(1z)-ylidenemethyl]-pyridine Small molecular drug D07ZCD
5-((1h-imidazol-1-yl)Methyl)-7,8-dihydroquinoline Small molecular drug D0Y0QI
5-(2-(1h-imidazol-1-yl)Ethyl)Quinoline Small molecular drug D0X8UK
5-bromo-8-imidazol-1-ylmethyl-chromen-4-one Small molecular drug D0UI8Q
5-indan-(1e)-ylidenemethyl-1h-imidazole Small molecular drug D03TRM
5-indan-(1z)-ylidenemethyl-1h-imidazole Small molecular drug D09QDY
5-pyridin-3-yl-1,3-dihydro-2h-indol-2-one Small molecular drug D0K2DR
5-pyridin-3-yl-2,3-dihydro-1h-inden-1-one Small molecular drug D0G9WP
5-[5-bromo-indan-(1e)-ylidenemethyl]-1h-imidazole Small molecular drug D0E9WX
5-[5-bromo-indan-(1z)-ylidenemethyl]-1h-imidazole Small molecular drug D02XHH
5-[5-fluoro-indan-(1e)-ylidenemethyl]-pyrimidine Small molecular drug D06HFV
5-[5-fluoro-indan-(1z)-ylidenemethyl]-pyrimidine Small molecular drug D04REX
5-[5-methoxy-indan-(1e)-ylidenemethyl]-thiazole Small molecular drug D0C8EO
5-[5-methoxy-indan-(1z)-ylidenemethyl]-thiazole Small molecular drug D0U6IT
6-imidazol-1-yl-isoquinoline Small molecular drug D08PKR
7,4'-dihydroxyflavone Small molecular drug D0SY6C
7-((1h-imidazol-1-yl)Methyl)-2h-chromen-2-one Small molecular drug D0OY1J
7-((1h-imidazol-1-yl)Methyl)-4h-chromen-4-one Small molecular drug D0DJ3R
7-((1h-imidazol-1-yl)Methyl)Isoquinoline Small molecular drug D0PU5V
7-(2-(1h-imidazol-1-yl)Ethoxy)-2h-chromen-2-one Small molecular drug D07TUX
7-hydroxy-2-(3-hydroxyphenyl)Chroman-4-one Small molecular drug D0Y0EK
7-hydroxy-2-phenylchroman-4-one Small molecular drug D05ZPO
7-[1,2,4]Triazol-4-ylmethyl-chromen-4-one Small molecular drug D0L9BT
8-imidazol-1-ylmethyl-5-nitro-chromen-4-one Small molecular drug D0V8SM
9-hydroxy-7,8-benzoflavone Small molecular drug D0V0DB
Albanol A Small molecular drug D01OQW
Alpha-naphthoflavone Small molecular drug D0I7GE
Androstenedone Small molecular drug D0W9PF
Apigenin Small molecular drug D00RIX
Benzyl-biphenyl-4-ylmethyl-imidazol-1-yl-amine Small molecular drug D0QL1V
Biochanin A Small molecular drug D0S9YX
Broussoflavonol F Small molecular drug D0W3LG
Cgs-18320b Small molecular drug D0V1UY
Chlorotrianisene Small molecular drug DB00269
Chrysin Small molecular drug D01UYI
Dehydroleucodin Small molecular drug D0U9QB
Docosapentaenoic Acid Small molecular drug D0Y8XJ
Flavone Small molecular drug D0S0RK
Gamma-mangostin Small molecular drug D05IWY
Garcinone D Small molecular drug D05YJR
Glyphosate Small molecular drug DB04539
Gossypetin Small molecular drug D0Z7EL
Isogemichalcone C Small molecular drug D09ZIW
Isolicoflavonol Small molecular drug D0E5FV
Liquirtigenin Small molecular drug D0K4PY
Ludartin Small molecular drug D06HJB
Mdl-18962 Small molecular drug D0M2IB
Monodictyochromone B Small molecular drug D0F8IB
Morachalcone A Small molecular drug D0U8JC
Mr-16089 Small molecular drug D08IIW
Mr-20492 Small molecular drug D0DO1T
Mr-20494 Small molecular drug D02LTV
Mr-20496 Small molecular drug D0R4WW
N-(2-benzyloxy-4-nitrophenyl)Methanesulfonamide Small molecular drug D0C5ZP
N-(2-hexyloxy-4-nitrophenyl)Methanesulfonamide Small molecular drug D0F9MQ
N-(2-nonyloxy-4-nitrophenyl)Methanesulfonamide Small molecular drug D04DZZ
N-(2-propyloxy-4-nitrophenyl)Methanesulfonamide Small molecular drug D0E3IK
N-[2-(4'-nitrophenyl)Ethyl]-imidazole Small molecular drug D0M0FE
Naringenin Small molecular drug DB03467
Nsc-122427 Small molecular drug D0R2YN
Nsc-12999 Small molecular drug D00ZPJ
Nsc-131736 Small molecular drug D06AZC
Nsc-289311 Small molecular drug D07PHT
Nsc-356483 Small molecular drug D06GIV
Nsc-356781 Small molecular drug D0S8MJ
Nsc-368272 Small molecular drug D08ARY
Nsc-368280 Small molecular drug D02QSH
Nsc-369087 Small molecular drug D0Y4TE
Nsc-613604 Small molecular drug D0M4CX
Nsc-625409 Small molecular drug D0Y9HD
Nsc-666292 Small molecular drug D0T3ED
Nsc-683634 Small molecular drug D0HR9S
Nsc-75308 Small molecular drug D08AAP
Nsc-93358 Small molecular drug D09MYQ
Nsc-94258 Small molecular drug D01KKU
Nsc-94891 Small molecular drug D0P5ZV
Org-33201 Small molecular drug D0Y1EX
(+/-)-7-methoxy-2-(4-methoxyphenyl)Chroman-4-one . D00HVZ
(+/-)-7-methoxy-2-phenylchroman-4-one . D0A2FO
1-(4-cyanobenzyl)-5-methyl-1h-imidazole . D05FFY
4-((1h-imidazol-1-yl)Methyl)Benzonitrile . D09HEA
6-((1h-imidazol-1-yl)Methyl)-2h-chromene-2-thione . D0T2IX
Carbendazim . DB13009
Endostatin . DB06423
Mpi-674 . DB05749
Mr-20814 . D00AVS
Withdrawn from market
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Formestane Small molecular drug D0B6PZ
Discontinued
Click To Hide/Show 9 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Drostanolone Small molecular drug DB00858
Etretinate Small molecular drug DB00926
Finrozole Small molecular drug D04PSL
Minamestane Small molecular drug D0FS9K
Nks-01 Small molecular drug D0U9LL
Rogletimide Small molecular drug D06JUR
Stanolone Small molecular drug DB02901
Vorozole Small molecular drug D0D3PF
Ym-511 Small molecular drug D0Y2OG

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.