General Information of Target

Target ID LDTP02482
Target Name Cytochrome c oxidase subunit 8A, mitochondrial (COX8A)
Gene Name COX8A
Gene ID 1351
Synonyms
COX8; COX8L; Cytochrome c oxidase subunit 8A, mitochondrial; Cytochrome c oxidase polypeptide VIII-liver/heart; Cytochrome c oxidase subunit 8-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE
Target Bioclass
Transporter and channel
Family
Cytochrome c oxidase VIII family
Subcellular location
Mitochondrion inner membrane
Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Uniprot ID
P10176
Ensemble ID
ENST00000314133.4
HGNC ID
HGNC:2294

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Acrolein
 Probe Info 
N.A.  LDD0217  [1]
Crotonaldehyde
 Probe Info 
N.A.  LDD0219  [1]
W1
 Probe Info 
S28(0.00); H27(0.00)  LDD0236  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H61(0.00); H27(0.00)  LDD0222  [1]
 LDCM0107  IAA HeLa H27(0.00); H61(0.00)  LDD0221  [1]
 LDCM0109  NEM HeLa H61(0.00); H27(0.00)  LDD0223  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Basic leucine zipper transcriptional factor ATF-like (BATF) BZIP family Q16520
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleophosmin (NPM1) Nucleoplasmin family P06748
Epididymal secretory protein E3-beta (EDDM3B) . P56851
Melanoma-associated antigen 4 (MAGEA4) . P43358

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cholic Acid Small molecular drug DB02659
Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
N-formylmethionine Small molecular drug DB04464

References

1 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
2 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.