Details of the Target
General Information of Target
| Target ID | LDTP02444 | |||||
|---|---|---|---|---|---|---|
| Target Name | Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) | |||||
| Gene Name | SLURP2 | |||||
| Gene ID | 432355 | |||||
| Synonyms |
Secreted Ly-6/uPAR domain-containing protein 2; Secreted LY6/PLAUR domain-containing protein 2; Secreted Ly-6/uPAR-related protein 2; SLURP-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTED
LPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ATP probe Probe Info |
 |
N.A. | LDD0199 | [1] | |