Details of the Target
General Information of Target
| Target ID | LDTP02427 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein SETSIP (SETSIP) | |||||
| Gene Name | SETSIP | |||||
| Gene ID | 646817 | |||||
| Synonyms |
SETP18; Protein SETSIP; SET pseudogene protein 18; SET similar protein; Similar to SET translocation protein |
|||||
| 3D Structure | ||||||
| Sequence |
MVWFLDFPNSMAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDE
VQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLG EEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTK IKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPL QYYLVPDMDDEEGGEDDDDDDDDGDEGEEELEDIDEGDEDEGEEDEDDDEGEEGEEDEGE DD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Nucleosome assembly protein (NAP) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Plays a role as a transcriptional activator involved in the early stage of somatic cell reprogramming. Promotes the differentiation of protein-induced pluripotent stem (PiPS) cells into endothelial cells and the formation of vascular-like tubes (in vitro). Involved in the transcription induction of vascular endothelial-cadherin (VE-cadherin) expression. Associates to the VE-cadherin gene promoter.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
E139(0.88); E165(1.01); E134(0.97); D173(0.92) | LDD2208 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y150(0.91); Y83(0.99) | LDD0264 | [2] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [3] | |
|
HHS-465 Probe Info |
![]() |
K199(0.00); K82(0.00); Y83(0.00); Y145(0.00) | LDD2240 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y150(0.91); Y83(0.99) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y83(1.00); Y150(1.18) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y150(0.95); Y83(1.04) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y150(0.85); Y83(0.96) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y150(0.96); Y83(1.00) | LDD0268 | [2] |
References




