Details of the Target
General Information of Target
| Target ID | LDTP02404 | |||||
|---|---|---|---|---|---|---|
| Target Name | Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 (JMJD7) | |||||
| Gene Name | JMJD7 | |||||
| Gene ID | 100137047 | |||||
| Synonyms |
Bifunctional peptidase and; 3S)-lysyl hydroxylase JMJD7; EC 1.14.11.63; EC 3.4.-.-; JmjC domain-containing protein 7; Jumonji domain-containing protein 7; L-lysine; 3S)-hydroxylase JMJD7 |
|||||
| 3D Structure | ||||||
| Sequence |
MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQH
WPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRA QHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD HYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPL DPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWYDMEYDLKY SYFQLLDSLTKASGLD |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Bifunctional enzyme that acts both as an endopeptidase and 2-oxoglutarate-dependent monooxygenase. Endopeptidase that cleaves histones N-terminal tails at the carboxyl side of methylated arginine or lysine residues, to generate 'tailless nucleosomes', which may trigger transcription elongation. Preferentially recognizes and cleaves monomethylated and dimethylated arginine residues of histones H2, H3 and H4. After initial cleavage, continues to digest histones tails via its aminopeptidase activity. Additionally, may play a role in protein biosynthesis by modifying the translation machinery. Acts as a Fe(2+) and 2-oxoglutarate-dependent monooxygenase, catalyzing (S)-stereospecific hydroxylation at C-3 of 'Lys-22' of DRG1 and 'Lys-21' of DRG2 translation factors (TRAFAC), promoting their interaction with ribonucleic acids (RNA).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Endophilin-B1 (SH3GLB1) | Endophilin family | Q9Y371 | |||
| Wolframin (WFS1) | . | O76024 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Chorion-specific transcription factor GCMb (GCM2) | . | O75603 | |||
| Pogo transposable element with ZNF domain (POGZ) | . | Q7Z3K3 | |||
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Oxoeicosanoid receptor 1 (OXER1) | G-protein coupled receptor 1 family | Q8TDS5 | |||
Other

