Details of the Target
General Information of Target
| Target ID | LDTP02391 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2A type 1 (H2AC11; H2AC13; H2AC15; H2AC16; H2AC17) | |||||
| Gene Name | H2AC11; H2AC13; H2AC15; H2AC16; H2AC17 | |||||
| Gene ID | 8329 | |||||
| Synonyms |
H2AFP; HIST1H2AG; H2AFC; HIST1H2AI; H2AFD; HIST1H2AK; H2AFI; HIST1H2AL; H2AFN; HIST1H2AM; Histone H2A type 1; H2A.1; Histone H2A/ptl |
|||||
| 3D Structure | ||||||
| Sequence |
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2A family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K119(7.61); K100(20.00) | LDD2217 | [1] | |
|
AZ-9 Probe Info |
![]() |
E92(1.09) | LDD2208 | [2] | |
|
OPA-S-S-alkyne Probe Info |
![]() |
K37(7.90) | LDD3494 | [3] | |
|
Probe 1 Probe Info |
![]() |
Y40(32.92) | LDD3495 | [4] | |
|
1c-yne Probe Info |
![]() |
K100(0.00); K96(0.00) | LDD0228 | [5] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
N.A. | LDD0137 | [6] | |
|
STS-2 Probe Info |
![]() |
N.A. | LDD0139 | [6] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RING2 (RNF2) | . | Q99496 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| 14-3-3 protein zeta/delta (YWHAZ) | 14-3-3 family | P63104 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| DnaJ homolog subfamily C member 2 (DNAJC2) | . | Q99543 | |||
| Peregrin (BRPF1) | . | P55201 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interleukin-33 (IL33) | IL-1 family | O95760 | |||
References







