Details of the Target
General Information of Target
Target ID | LDTP02391 | |||||
---|---|---|---|---|---|---|
Target Name | Histone H2A type 1 (H2AC11; H2AC13; H2AC15; H2AC16; H2AC17) | |||||
Gene Name | H2AC11; H2AC13; H2AC15; H2AC16; H2AC17 | |||||
Gene ID | 8329 | |||||
Synonyms |
H2AFP; HIST1H2AG; H2AFC; HIST1H2AI; H2AFD; HIST1H2AK; H2AFI; HIST1H2AL; H2AFN; HIST1H2AM; Histone H2A type 1; H2A.1; Histone H2A/ptl |
|||||
3D Structure | ||||||
Sequence |
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Histone H2A family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K119(7.61); K100(20.00) | LDD2217 | [1] | |
AZ-9 Probe Info |
![]() |
E92(1.09) | LDD2208 | [2] | |
OPA-S-S-alkyne Probe Info |
![]() |
K37(7.90) | LDD3494 | [3] | |
Probe 1 Probe Info |
![]() |
Y40(32.92) | LDD3495 | [4] | |
1c-yne Probe Info |
![]() |
K100(0.00); K96(0.00) | LDD0228 | [5] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STS-1 Probe Info |
![]() |
N.A. | LDD0137 | [6] | |
STS-2 Probe Info |
![]() |
N.A. | LDD0139 | [6] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
E3 ubiquitin-protein ligase RING2 (RNF2) | . | Q99496 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
14-3-3 protein zeta/delta (YWHAZ) | 14-3-3 family | P63104 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
DnaJ homolog subfamily C member 2 (DNAJC2) | . | Q99543 | |||
Peregrin (BRPF1) | . | P55201 |
Cytokine and receptor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Interleukin-33 (IL33) | IL-1 family | O95760 |
References