Details of the Target
General Information of Target
| Target ID | LDTP02379 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1) | |||||
| Gene Name | IFIT1 | |||||
| Gene ID | 3434 | |||||
| Synonyms |
G10P1; IFI56; IFNAI1; ISG56; Interferon-induced protein with tetratricopeptide repeats 1; IFIT-1; Interferon-induced 56 kDa protein; IFI-56K; P56 |
|||||
| 3D Structure | ||||||
| Sequence |
MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
IFIT family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Interferon-induced antiviral RNA-binding protein that specifically binds single-stranded RNA bearing a 5'-triphosphate group (PPP-RNA), thereby acting as a sensor of viral single-stranded RNAs and inhibiting expression of viral messenger RNAs. Single-stranded PPP-RNAs, which lack 2'-O-methylation of the 5' cap and bear a 5'-triphosphate group instead, are specific from viruses, providing a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Directly binds PPP-RNA in a non-sequence-specific manner. Viruses evolved several ways to evade this restriction system such as encoding their own 2'-O-methylase for their mRNAs or by stealing host cap containing the 2'-O-methylation (cap snatching mechanism). Exhibits antiviral activity against several viruses including human papilloma and hepatitis C viruses.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A498 | Insertion: p.Y261LfsTer9 | . | |||
| CAKI1 | SNV: p.I291M | . | |||
| IM95 | SNV: p.E360D | . | |||
| LS180 | SNV: p.L443F | . | |||
| MSTO211H | SNV: p.Y459C | DBIA Probe Info | |||
| RKO | Deletion: p.K336SfsTer9 | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K120(5.88); K127(9.62); K192(5.79); K269(5.88) | LDD0277 | [1] | |
|
DBIA Probe Info |
 |
C294(4.36); C94(2.45) | LDD3316 | [2] | |
|
BTD Probe Info |
 |
C163(0.32) | LDD2122 | [3] | |
|
IA-alkyne Probe Info |
 |
C138(2.18) | LDD2214 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-2 Probe Info |
 |
N.A. | LDD0139 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0630 | CCW28-3 | 231MFP | C138(2.18) | LDD2214 | [4] |
| LDCM0022 | KB02 | BRX29 | C94(1.78) | LDD2270 | [2] |
| LDCM0023 | KB03 | BRX394 | C94(2.55) | LDD2691 | [2] |
| LDCM0024 | KB05 | MEL167 | C294(4.36); C94(2.45) | LDD3316 | [2] |
| LDCM0529 | Nucleophilic fragment 27b | MDA-MB-231 | C163(0.32) | LDD2122 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Stimulator of interferon genes protein (STING1) | STING family | Q86WV6 | |||
Other
References