Details of the Target
General Information of Target
| Target ID | LDTP02357 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein Wnt-2 (WNT2) | |||||
| Gene Name | WNT2 | |||||
| Gene ID | 7472 | |||||
| Synonyms |
INT1L1; IRP; Protein Wnt-2; Int-1-like protein 1; Int-1-related protein; IRP |
|||||
| 3D Structure | ||||||
| Sequence |
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Wnt family
|
|||||
| Subcellular location |
Secreted, extracellular space, extracellular matrix
|
|||||
| Function |
Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. Functions as a upstream regulator of FGF10 expression. Plays an important role in embryonic lung development. May contribute to embryonic brain development by regulating the proliferation of dopaminergic precursors and neurons.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C96(3.62) | LDD3443 | [1] | |
Competitor(s) Related to This Target

