Details of the Target
General Information of Target
| Target ID | LDTP02340 | |||||
|---|---|---|---|---|---|---|
| Target Name | Growth-regulated alpha protein (CXCL1) | |||||
| Gene Name | CXCL1 | |||||
| Gene ID | 2919 | |||||
| Synonyms |
GRO; GRO1; GROA; MGSA; SCYB1; Growth-regulated alpha protein; C-X-C motif chemokine 1; GRO-alpha(1-73); Melanoma growth stimulatory activity; MGSA; Neutrophil-activating protein 3; NAP-3) [Cleaved into: GRO-alpha(4-73; GRO-alpha(5-73; GRO-alpha(6-73)]
|
|||||
| 3D Structure | ||||||
| Sequence |
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine alpha (chemokine CxC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C85(1.92) | LDD3369 | [1] | |
|
BTD Probe Info |
![]() |
C85(0.83) | LDD2120 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | A101D | C85(2.34) | LDD2250 | [1] |
| LDCM0023 | KB03 | A101D | C85(4.03) | LDD2667 | [1] |
| LDCM0024 | KB05 | OAW-42 | C85(1.92) | LDD3369 | [1] |
| LDCM0527 | Nucleophilic fragment 26b | MDA-MB-231 | C85(0.83) | LDD2120 | [2] |
| LDCM0535 | Nucleophilic fragment 30b | MDA-MB-231 | C85(0.75) | LDD2128 | [2] |
References


