Details of the Target
General Information of Target
| Target ID | LDTP02276 | |||||
|---|---|---|---|---|---|---|
| Target Name | Matrix Gla protein (MGP) | |||||
| Gene Name | MGP | |||||
| Gene ID | 4256 | |||||
| Synonyms |
MGLAP; Matrix Gla protein; MGP; Cell growth-inhibiting gene 36 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRE
RSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYFRKRRGTK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Osteocalcin/matrix Gla protein family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C98(1.62) | LDD2270 | [1] | |
Competitor(s) Related to This Target