Details of the Target

General Information of Target

Target ID LDTP02192
Target Name Asialoglycoprotein receptor 2 (ASGR2)
Gene Name ASGR2
Gene ID 433
Synonyms
CLEC4H2; Asialoglycoprotein receptor 2; ASGP-R 2; ASGPR 2; C-type lectin domain family 4 member H2; Hepatic lectin H2; HL-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFS
LLALSFNILLLVVICVTGSQSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGS
VGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVN
WVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDS
DGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVC
EKRRNATGEVA
Target Bioclass
Other
Subcellular location
Membrane
Function
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Uniprot ID
P07307
Ensemble ID
ENST00000254850.11
HGNC ID
HGNC:743

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD0241  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heme oxygenase 2 (HMOX2) Heme oxygenase family P30519
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
Fatty acid 2-hydroxylase (FA2H) Sterol desaturase family Q7L5A8
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
UbiA prenyltransferase domain-containing protein 1 (UBIAD1) UbiA prenyltransferase family Q9Y5Z9
V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) V-ATPase proteolipid subunit family P27449
Ceramide synthase 2 (CERS2) . Q96G23
Transporter and channel
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Membrane-spanning 4-domains subfamily A member 13 (MS4A13) MS4A family Q5J8X5
CMP-sialic acid transporter (SLC35A1) Nucleotide-sugar transporter family P78382
Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (SLC35B2) Nucleotide-sugar transporter family Q8TB61
Transferrin receptor protein 1 (TFRC) Peptidase M28 family P02786
Cardiac phospholamban (PLN) Phospholamban family P26678
Peripheral myelin protein 22 (PMP22) PMP-22/EMP/MP20 family Q01453
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Translocating chain-associated membrane protein 1-like 1 (TRAM1L1) TRAM family Q8N609
Translocator protein 2 (TSPO2) TspO/BZRP family Q5TGU0
Uroplakin-2 (UPK2) Uroplakin-2 family O00526
Vesicle transport through interaction with t-SNAREs homolog 1B (VTI1B) VTI1 family Q9UEU0
Protein YIPF1 (YIPF1) YIP1 family Q9Y548
Adiponectin (ADIPOQ) . Q15848
Proteolipid protein 2 (PLP2) . Q04941
Transmembrane protein 60 (TMEM60) . Q9H2L4
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BET1 homolog (BET1) BET1 family O15155
ORM1-like protein 1 (ORMDL1) ORM family Q9P0S3
Epithelial membrane protein 1 (EMP1) PMP-22/EMP/MP20 family P54849
Protein reprimo (RPRM) Reprimo family Q9NS64
Vesicle-associated membrane protein 5 (VAMP5) Synaptobrevin family O95183
Vesicle-trafficking protein SEC22a (SEC22A) Synaptobrevin family Q96IW7
Syntaxin-8 (STX8) Syntaxin family Q9UNK0
C-type lectin domain family 17, member A (CLEC17A) . Q6ZS10
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Mast cell-expressed membrane protein 1 (MCEMP1) . Q8IX19
Small integral membrane protein 3 (SMIM3) . Q9BZL3
Transmembrane protein 140 (TMEM140) . Q9NV12

The Drug(s) Related To This Target

Approved
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Antihemophilic Factor Human Recombinant BiotechDrug DB00025
Lonoctocog Alfa . DB13998
Moroctocog Alfa . DB13999

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.