Details of the Target
General Information of Target
| Target ID | LDTP02105 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endothelin-1 (EDN1) | |||||
| Gene Name | EDN1 | |||||
| Gene ID | 1906 | |||||
| Synonyms |
Endothelin-1; Preproendothelin-1; PPET1) [Cleaved into: Endothelin-1; ET-1; Big endothelin-1] |
|||||
| 3D Structure | ||||||
| Sequence |
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Endothelin/sarafotoxin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Endothelins are endothelium-derived vasoconstrictor peptides. Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells. Also binds the DEAR/FBXW7-AS1 receptor. Promotes mesenteric arterial wall remodeling via activation of ROCK signaling and subsequent colocalization of NFATC3 with F-actin filaments. NFATC3 then translocates to the nucleus where it subsequently promotes the transcription of the smooth muscle hypertrophy and differentiation marker ACTA2.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C155(19.70) | LDD2236 | [1] | |