Details of the Target
General Information of Target
| Target ID | LDTP02083 | |||||
|---|---|---|---|---|---|---|
| Target Name | Non-histone chromosomal protein HMG-14 (HMGN1) | |||||
| Gene Name | HMGN1 | |||||
| Gene ID | 3150 | |||||
| Synonyms |
HMG14; Non-histone chromosomal protein HMG-14; High mobility group nucleosome-binding domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKG
KQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
HMGN family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K53(10.00) | LDD0277 | [1] | |
|
NHS Probe Info |
![]() |
K14(0.00); K71(0.00) | LDD0010 | [2] | |
|
SF Probe Info |
![]() |
K5(0.00); K42(0.00) | LDD0028 | [3] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0357 | [4] | |
References




