Details of the Target
General Information of Target
| Target ID | LDTP02070 | |||||
|---|---|---|---|---|---|---|
| Target Name | Fructose-bisphosphate aldolase B (ALDOB) |
|
||||
| Gene Name | ALDOB | |||||
| Gene ID | 229 | |||||
| Synonyms |
ALDB; Fructose-bisphosphate aldolase B; EC 4.1.2.13; Liver-type aldolase |
|||||
| 3D Structure | ||||||
| Sequence |
MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA CYTY |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Class I fructose-bisphosphate aldolase family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite
|
|||||
| Function |
Catalyzes the aldol cleavage of fructose 1,6-biphosphate to form two triosephosphates dihydroxyacetone phosphate and D-glyceraldehyde 3-phosphate in glycolysis as well as the reverse stereospecific aldol addition reaction in gluconeogenesis. In fructolysis, metabolizes fructose 1-phosphate derived from the phosphorylation of dietary fructose by fructokinase into dihydroxyacetone phosphate and D-glyceraldehyde. Acts as an adapter independently of its enzymatic activity, exerts a tumor suppressor role by stabilizing the ternary complex with G6PD and TP53 to inhibit G6PD activity and keep oxidative pentose phosphate metabolism in check.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C256(1.98) | LDD3311 | [1] | |
|
HHS-475 Probe Info |
 |
Y138(1.22) | LDD0264 | [2] | |
|
HHS-465 Probe Info |
 |
Y138(10.00) | LDD2237 | [3] | |
|
IA-alkyne Probe Info |
 |
C269(0.00); C290(0.00) | LDD2242 | [4] | |
|
IPM Probe Info |
 |
C240(0.00); C269(0.00) | LDD2156 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y138(1.22) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y138(0.93) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y138(0.85) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y138(0.96) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y138(1.93) | LDD0268 | [2] |
| LDCM0022 | KB02 | 22RV1 | C256(2.03) | LDD2243 | [1] |
| LDCM0023 | KB03 | 22RV1 | C256(2.01) | LDD2660 | [1] |
| LDCM0024 | KB05 | G361 | C256(1.98) | LDD3311 | [1] |
The Interaction Atlas With This Target
References