General Information of Target

Target ID LDTP01994
Target Name Antileukoproteinase (SLPI)
Gene Name SLPI
Gene ID 6590
Synonyms
WAP4; WFDC4; Antileukoproteinase; ALP; BLPI; HUSI-1; Mucus proteinase inhibitor; MPI; Protease inhibitor WAP4; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; WAP four-disulfide core domain protein 4
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG
MCGKSCVSPVKA
Target Bioclass
Other
Subcellular location
Secreted
Function
Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G . Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells.
Uniprot ID
P03973
Ensemble ID
ENST00000338380.2
HGNC ID
HGNC:11092

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C43(1.59)  LDD3337  [1]
IA-alkyne
 Probe Info 
C126(0.00); C72(0.00); C43(0.00); C51(0.00)  LDD0162  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 COR-L88 C43(0.71)  LDD2311  [1]
 LDCM0023  KB03 HCC1187 C43(2.42)  LDD2754  [1]
 LDCM0024  KB05 MSTO-211H C43(1.59)  LDD3337  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM9B (FAM9B) FAM9 family Q8IZU0
EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1) Fibulin family Q12805
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Calcium and integrin-binding family member 3 (CIB3) . Q96Q77
Calcium-binding protein 8 (CALN1) . Q9BXU9
Small integral membrane protein 14 (SMIM14) . Q96QK8
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060