Details of the Target
General Information of Target
| Target ID | LDTP01994 | |||||
|---|---|---|---|---|---|---|
| Target Name | Antileukoproteinase (SLPI) | |||||
| Gene Name | SLPI | |||||
| Gene ID | 6590 | |||||
| Synonyms |
WAP4; WFDC4; Antileukoproteinase; ALP; BLPI; HUSI-1; Mucus proteinase inhibitor; MPI; Protease inhibitor WAP4; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; WAP four-disulfide core domain protein 4
|
|||||
| 3D Structure | ||||||
| Sequence |
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG MCGKSCVSPVKA |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G . Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C43(1.59) | LDD3337 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C126(0.00); C72(0.00); C43(0.00); C51(0.00) | LDD0162 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protein N-terminal glutamine amidohydrolase (NTAQ1) | NTAQ1 family | Q96HA8 | |||
| Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) | . | Q13064 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein Hox-A1 (HOXA1) | Antp homeobox family | P49639 | |||
Other
References


