Details of the Target

General Information of Target

Target ID LDTP01960
Target Name Alpha-1-acid glycoprotein 1 (ORM1)
Gene Name ORM1
Gene ID 5004
Synonyms
AGP1; Alpha-1-acid glycoprotein 1; AGP 1; Orosomucoid-1; OMD 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES
Target Bioclass
Other
Family
Calycin superfamily, Lipocalin family
Subcellular location
Secreted
Function
Functions as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Uniprot ID
P02763
Ensemble ID
ENST00000259396.9
HGNC ID
HGNC:8498
ChEMBL ID
CHEMBL4285

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
W1
 Probe Info  		N.A.  LDD0236  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Plasminogen activator inhibitor 1 (SERPINE1) Serpin family P05121

The Drug(s) Related To This Target

Approved
Click To Hide/Show 120 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Abemaciclib Small molecular drug DB12001
Abiraterone Small molecular drug DB05812
Acalabrutinib Small molecular drug DB11703
Acenocoumarol Small molecular drug DB01418
Ajmaline Small molecular drug DB01426
Alfentanil Small molecular drug DB00802
Alfuzosin Small molecular drug DB00346
Amitriptyline Small molecular drug DB00321
Amoxapine Small molecular drug DB00543
Amsacrine Small molecular drug DB00276
Argatroban Small molecular drug DB00278
Asenapine Small molecular drug DB06216
Atazanavir Small molecular drug DB01072
Atomoxetine Small molecular drug DB00289
Atropine Small molecular drug DB00572
Avanafil Small molecular drug DB06237
Benzocaine Small molecular drug DB01086
Bupropion Small molecular drug DB01156
Buspirone Small molecular drug DB00490
Canagliflozin Small molecular drug DB08907
Carbinoxamine Small molecular drug DB00748
Chloroquine Small molecular drug DB00608
Chlorpromazine Small molecular drug DB00477
Clindamycin Small molecular drug DB01190
Cobimetinib Small molecular drug DB05239
Cocaine Small molecular drug DB00907
Crizotinib Small molecular drug DB08865
Darunavir Small molecular drug DB01264
Desipramine Small molecular drug DB01151
Diltiazem Small molecular drug DB00343
Dipyridamole Small molecular drug DB00975
Disopyramide Small molecular drug DB00280
Dolutegravir Small molecular drug DB08930
Doxepin Small molecular drug DB01142
Duloxetine Small molecular drug DB00476
Dutasteride Small molecular drug DB01126
Erlotinib Small molecular drug DB00530
Estetrol Small molecular drug DB12235
Favipiravir Small molecular drug DB12466
Fentanyl Small molecular drug DB00813
Fexofenadine Small molecular drug DB00950
Flecainide Small molecular drug DB01195
Fluoxetine Small molecular drug DB00472
Gefitinib Small molecular drug DB00317
Glycopyrronium Small molecular drug DB00986
Hydroxychloroquine Small molecular drug DB01611
Ibrutinib Small molecular drug DB09053
Imatinib Small molecular drug DB00619
Imipramine Small molecular drug DB00458
Indapamide Small molecular drug DB00808
Ipratropium Small molecular drug DB00332
Irbesartan Small molecular drug DB01029
Istradefylline Small molecular drug DB11757
Ivacaftor Small molecular drug DB08820
Labetalol Small molecular drug DB00598
Lidocaine Small molecular drug DB00281
Lopinavir Small molecular drug DB01601
Macitentan Small molecular drug DB08932
Maprotiline Small molecular drug DB00934
Maribavir Small molecular drug DB06234
Meperidine Small molecular drug DB00454
Methadone Small molecular drug DB00333
Metoclopramide Small molecular drug DB01233
Mirabegron Small molecular drug DB08893
Nadolol Small molecular drug DB01203
Nateglinide Small molecular drug DB00731
Nelfinavir Small molecular drug DB00220
Neratinib Small molecular drug DB11828
Nifedipine Small molecular drug DB01115
Nomifensine Small molecular drug DB04821
Nortriptyline Small molecular drug DB00540
Olanzapine Small molecular drug DB00334
Olaparib Small molecular drug DB09074
Oxybutynin Small molecular drug DB01062
Oxycodone Small molecular drug DB00497
Penbutolol Small molecular drug DB01359
Phenprocoumon Small molecular drug DB00946
Pindolol Small molecular drug DB00960
Pitavastatin Small molecular drug DB08860
Pitolisant Small molecular drug DB11642
Prazosin Small molecular drug DB00457
Progesterone Small molecular drug DB00396
Propranolol Small molecular drug DB00571
Quinidine Small molecular drug DB00908
Raloxifene Small molecular drug DB00481
Ranolazine Small molecular drug DB00243
Relugolix Small molecular drug DB11853
Remoxipride Small molecular drug DB00409
Rifampicin Small molecular drug DB01045
Riociguat Small molecular drug DB08931
Risperidone Small molecular drug DB00734
Ritonavir Small molecular drug DB00503
Ropivacaine Small molecular drug DB00296
Salmeterol Small molecular drug DB00938
Saquinavir Small molecular drug DB01232
Selumetinib Small molecular drug DB11689
Sirolimus Small molecular drug DB00877
Solifenacin Small molecular drug DB01591
Spironolactone Small molecular drug DB00421
Tacrolimus Small molecular drug DB00864
Tamsulosin Small molecular drug DB00706
Telaprevir Small molecular drug DB05521
Tepotinib Small molecular drug DB15133
Terbinafine Small molecular drug DB00857
Terfenadine Small molecular drug DB00342
Thalidomide Small molecular drug DB01041
Ulipristal Small molecular drug DB08867
Vandetanib Small molecular drug DB05294
Vemurafenib Small molecular drug DB08881
Verapamil Small molecular drug DB00661
Vismodegib Small molecular drug DB08828
Warfarin Small molecular drug DB00682
Ziprasidone Small molecular drug DB00246
Belumosudil . DB16703
Butamben . DB11148
Futibatinib . DB15149
Grazoprevir . DB11575
Pexidartinib . DB12978
Ripretinib . DB14840
Vinflunine . DB11641
Investigative
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Aprindine Small molecular drug DB01429
Topiroxostat Small molecular drug DB01685
Aranidipine . DB09229
Arotinolol . DB09204
Imidafenacin . DB09262

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.