Details of the Target
General Information of Target
| Target ID | LDTP01939 | |||||
|---|---|---|---|---|---|---|
| Target Name | Apolipoprotein C-II (APOC2) | |||||
| Gene Name | APOC2 | |||||
| Gene ID | 344 | |||||
| Synonyms |
APC2; Apolipoprotein C-II; Apo-CII; ApoC-II; Apolipoprotein C2) [Cleaved into: Proapolipoprotein C-II; ProapoC-II)] |
|||||
| 3D Structure | ||||||
| Sequence |
MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Apolipoprotein C2 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K61(9.09) | LDD0277 | [1] | |