Details of the Target
General Information of Target
| Target ID | LDTP01937 | |||||
|---|---|---|---|---|---|---|
| Target Name | Apolipoprotein A-II (APOA2) | |||||
| Gene Name | APOA2 | |||||
| Gene ID | 336 | |||||
| Synonyms |
Apolipoprotein A-II; Apo-AII; ApoA-II; Apolipoprotein A2) [Cleaved into: Proapolipoprotein A-II; ProapoA-II; Truncated apolipoprotein A-II; Apolipoprotein A-II(1-76))] |
|||||
| 3D Structure | ||||||
| Sequence |
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Apolipoprotein A2 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| 17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) | Short-chain dehydrogenases/reductases (SDR) family | Q7Z5P4 | |||
Transporter and channel
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) | Immunoglobulin superfamily | P43628 | |||
Other
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Infigratinib | Small molecular drug | DB11886 | |||
| Sirolimus | Small molecular drug | DB00877 | |||
| Copper | . | DB09130 | |||
| Zinc | . | DB01593 | |||
| Zinc Acetate | . | DB14487 | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| B-octylglucoside | Small molecular drug | D02UVH | |||

