Details of the Target
General Information of Target
| Target ID | LDTP01921 | |||||
|---|---|---|---|---|---|---|
| Target Name | Hemoglobin subunit delta (HBD) | |||||
| Gene Name | HBD | |||||
| Gene ID | 3045 | |||||
| Synonyms |
Hemoglobin subunit delta; Delta-globin; Hemoglobin delta chain |
|||||
| 3D Structure | ||||||
| Sequence |
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFG KEFTPQMQAAYQKVVAGVANALAHKYH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Globin family
|
|||||
| Function | Involved in oxygen transport from the lung to the various peripheral tissues. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C94(1.76) | LDD2324 | [1] | |
Competitor(s) Related to This Target