Details of the Target
General Information of Target
| Target ID | LDTP01866 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interferon alpha-5 (IFNA5) | |||||
| Gene Name | IFNA5 | |||||
| Gene ID | 3442 | |||||
| Synonyms |
Interferon alpha-5; IFN-alpha-5; Interferon alpha-61; Interferon alpha-G; LeIF G |
|||||
| 3D Structure | ||||||
| Sequence |
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN LQERLRRKE |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Alpha/beta interferon family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [1] | |
The Interaction Atlas With This Target

