Details of the Target
General Information of Target
| Target ID | LDTP01841 | |||||
|---|---|---|---|---|---|---|
| Target Name | Glycoprotein hormones alpha chain (CGA) |
|
||||
| Gene Name | CGA | |||||
| Gene ID | 1081 | |||||
| Synonyms |
Glycoprotein hormones alpha chain; Anterior pituitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha; CG-alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain
|
|||||
| 3D Structure | ||||||
| Sequence |
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Glycoprotein hormones subunit alpha family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-465 Probe Info |
 |
N.A. | LDD2240 | [1] | |